Identifiers and Description

Gene Model Identifier

TTHERM_00647130

Standard Name

ALT1 (Alpha-Like Tubulin 1)

Aliases

PreTt15819 | 93.m00115 | 3727.m00035

Description

ALT1 tubulin/FtsZ family GTPase domain protein; Alpha-like tubulin protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19119.1 9.998596099208102e-158
Description: tubulin/FtsZ family, GTPase domain-containing protein (448 aa)
Oxytricha Contig22199.0.g119 6.000220702367707e-121
Description: Tubulin/FtsZ family, GTPase domain
WormBase WBGene00006530 3.998986577109865e-118
Description: locus:tba-4 status:Confirmed UniProt:G5EDD4 protein_id:CAA85463.1
DictyBase DDB_G0287689 9.002752962930884e-112
Description: tubA on chromosome: 5 position 707217 to 708704
SGD YML085C 7.0000984021781654e-99
Description: TUB1 Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules
Stentor Coeruleus SteCoe_38102 2.820770088460135e-53
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00647130(coding)
ATGGGAGAAATAATAAACGTTTTCGTTGGATAATACGGAGTACAATCAGGATAGGAATAT
TGGAAATAAATTTGTTTAGAACACAATATTAATTCTTATGGATAAAAATTAACTTAGTAA
TAAGATGATAATGAAAATGTAACTTGCTTTTTTAGTGAATCAGAGAAATAAAAATATGTT
CCTCGATGTGTGTTTTTGGATTTAGATGCAACTCCTATTGATGAAATAAGGAAAAAAAGT
AGCAGCTTTTTTAGAAAAGATTGCTTAATATCTGGTAAAGAAGATTGTGGAAGCAATTGT
GTTAGAGGGAAATATACACTCGGAAAAGAAATATGCGATATTGCTCTTGACTAGATAAGA
TTAGAGGCAAATAAATGCGAAAATTTATAAGGTTTTATAATTCACAGATCTCTTAATGGA
GGGACTGGTAATGGTGTTGGTAACTTAATTTGTGATAGGCTCTCAAGAGATTATAATAAA
AAAGTTAAAATAAATTCATTGCTCTTTCCATCTAATAATATTGCAAATGAAGTTGTTGAA
CCCTTTAATTTTGTCCTTGGCATGTATGATATTTTAGAACACTAAGAGATGAGCTTATCA
TTTTAAAATGAACAAATTTACAAATTTGCAGATAATTATTTAGATATTGAGTAACTCGAT
TACTAAAATATTAACTAATTAACCAGCATTATAAACTCTTCACTTACACATTCAATGCGT
TTTAAAGGCGACTTAAACTATAATATGGCAAATTTAGTAACTAATTTAGTTTGTTATCCA
AGAATTAATAACACCATACCCTCTTATTGTTCTTCTAATTTTAATTTCATCAAAGAAAAA
TGTGGTTAACCTACAGTAAATATGTTATGTTCTAGTTTATTTAACAAATAAAACTTTTTT
GTTGATTGTAATCCATAACAAGGTAAGTATTTATCTTGTTGTTTAACTGCAAGAGGAGAT
ATATATCCTAGATAAATTAGTGAATCTATAAAAATAATCAAATCTAAACAATCAATTGAT
TTTGTTGATTTCATTCCTACTGGTATTAAAGTTGGAGTATGCTAAAAGTAGCCTAAAAAT
TTACTACATAAAGAATATGAATCTAAATTTCAAAGGGATGCTATTTTATTAGCCAATAAT
ACTTCAATTAATTCTATATTTTAAATTATGGCTTAAAAATTTAATAAAATGTATGATAAA
AGAGCATTTGTTCATTGGTATGTGGGTGAAGGAATGGAATCAGATGAATTTGCATGCGCG
AGAGAGAATTTATTGGCTATAATTAAGGATTATGAAGAAGTCTCTACTGAAACGAATGAA
AATTTCCTAGAAGAGGATGATGATATTATAGAAATATGA


>TTHERM_00647130(gene)
ATGGGAGAAATAATAAACGTTTTCGTTGGATAATACGGAGTACAATCAGGATAGGAATAT
TGGAAATAAATTTGTTTAGAACACAATATTAATTCTTATGGATAAAAATTAACTTAGTAA
TAAGATGATAATGAAAATGTAACTTGCTTTTTTAGTGAATCAGAGAAATAAAAATATGTT
CCTCGATGTGTGTTTTTGGATTTAGATGCAACTCCTATTGATGAAATAAGGAAAAAAAGT
AGCAGCTTTTTTAGAAAAGATTGCTTAATATCTGGTAAAGAAGATTGTGGAAGCAATTGT
GTTAGAGGGAAATATACACTCGGAAAAGAAATATGCGATATTGCTCTTGACTAGATAAGA
TTAGAGGCAAATAAATGCGAAAATTTATAAGGTTTTATAATTCACAGATCTCTTAATGGA
GGGACTGGTAATGGTGTTGGTAACTTAATTTGTGATAGGCTCTCAAGAGATTATAATAAA
AAAGTTAAAATAAATTCATTGCTCTTTCCATCTAATAATATTGCAAATGAAGTTGTTGAA
CCCTTTAATTTTGTCCTTGGCATGTATGATATTTTAGAACACTAAGAGATGAGCTTATCA
TTTTAAAATGAACAAATTTACAAATTTGCAGATAATTATTTAGATATTGAGTAACTCGAT
TACTAAAATATTAACTAATTAACCAGCATTATAAACTCTTCACTTACACATTCAATGCGT
TTTAAAGGCGACTTAAACTATAATATGGCAAATTTAGTAACTAATTTAGTTTGTTATCCA
AGAATTAATAACACCATACCCTCTTATTGTTCTTCTAATTTTAATTTCATCAAAGAAAAA
TGTGGTTAACCTACAGTAAATATGTTATGTTCTAGTTTATTTAACAAATAAAACTTTTTT
GTTGATTGTAATCCATAACAAGGTAAGTATTTATCTTGTTGTTTAACTGCAAGAGGAGAT
ATATATCCTAGATAAATTAGTGAATCTATAAAAATAATCAAATCTAAACAATCAATTGAT
TTTGTTGATTTCATTCCTACTGGTATTAAAGTTGGAGTATGCTAAAAGTAGCCTAAAAAT
TTACTACATAAAGAATATGAATCTAAATTTCAAAGGGATGCTATTTTATTAGCCAATAAT
ACTTCAATTAATTCTATATTTTAAATTATGGCTTAAAAATTTAATAAAATGTATGATAAA
AGAGCATTTGTTCATTGGTATGTGGGTGAAGGAATGGAATCAGATGAATTTGCATGCGCG
AGAGAGAATTTATTGGCTATAATTAAGGATTATGAAGAAGTCTCTACTGAAACGAATGAA
AATTTCCTAGAAGAGGATGATGATATTATAGAAATATGA


>TTHERM_00647130(protein)
MGEIINVFVGQYGVQSGQEYWKQICLEHNINSYGQKLTQQQDDNENVTCFFSESEKQKYV
PRCVFLDLDATPIDEIRKKSSSFFRKDCLISGKEDCGSNCVRGKYTLGKEICDIALDQIR
LEANKCENLQGFIIHRSLNGGTGNGVGNLICDRLSRDYNKKVKINSLLFPSNNIANEVVE
PFNFVLGMYDILEHQEMSLSFQNEQIYKFADNYLDIEQLDYQNINQLTSIINSSLTHSMR
FKGDLNYNMANLVTNLVCYPRINNTIPSYCSSNFNFIKEKCGQPTVNMLCSSLFNKQNFF
VDCNPQQGKYLSCCLTARGDIYPRQISESIKIIKSKQSIDFVDFIPTGIKVGVCQKQPKN
LLHKEYESKFQRDAILLANNTSINSIFQIMAQKFNKMYDKRAFVHWYVGEGMESDEFACA
RENLLAIIKDYEEVSTETNENFLEEDDDIIEI