Identifiers and Description

Gene Model Identifier

TTHERM_00194810

Standard Name

MSH6 (homolog to human protein MSH6)

Aliases

PreTt06765 | 16.m00421

Description

MSH6 MutS domain III protein; MutS domain III family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • obsolete protein-FMN linkage via 1'-(8alpha-FMN)-L-histidine (IEA) | GO:0050743
  • photosynthetic electron transport in photosystem II (IEA) | GO:0009772

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03750.1 9.997093137033517e-262
Description: MutS domain III family protein (1232 aa)
Oxytricha Contig820.1.g122 9.997093137033517e-262
Description: MutS domain V
DictyBase DDB_G0268614 2.0004037638327014e-151
Description: msh6 on chromosome: 1 position 238722 to 242663
WormBase WBGene00003422 2.998573346093879e-125
Description: locus:msh-6 status:Partially_confirmed UniProt:Q9N3T8 protein_id:CCD72556.1
SGD YDR097C 9.995417076252815e-72
Description: MSH6 Protein required for mismatch repair in mitosis and meiosis, forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; potentially phosphorylated by Cdc28p
Stentor Coeruleus SteCoe_17585 1.6458114310822737e-38
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194810(coding)
ATGAAGCAAAGTTCACTATTAAGCTTTTTTGGAAATGTGTAGAGAAGGAAAAGAGAAGAG
ATGGAGAAGGAATAGGCCTAAAACGATAATAAAATTGCTGAATCCACTCAAATTTCTTTA
TCTACATAAAAGAGCAATAAAGAAGTTAAGGAAATTTCTACTTGTGATGATACAGAAGTA
GCAAATTCAAGCGTTTAGGGTACCAGAAAAAGTAATTTAAAACGTCCTAAATTGGCAATA
GATTCTGATGAAGATGATGTTTTTAATCCAGAAGATTTAAAATAATTTTCTCATACTAGC
CCTTAGAAAAATAGCTAGAAAAAAGGAATAAGGTTTTAAAAAAATGATATGATTGATGAA
GATAATGATGATGAATCTTTTAAGGAAGATGATATAGAAGACATTGAAGATGAAGAAGAT
GATGATGATTTTATTGAAGATAGTGATGAAGAAGTTAAGCCTAAACGCAAACAAAAACAA
AGTTAGTAAAAAACACCTGTCAAGAAAACTGGTTCAGCTTCAAAAGCAGGAGCAACAAAG
AGTACTCCCAAATTTGGATAAGAAAGTGCTAAAAAATCAGCAACTAAATAAAGTACAGCT
AAAAAAGCAGAAGATGAGTTTATAAATTGTGATTAAGAAAATGATTTAGCAAGAGCTGCT
GTAGATTAATTAGATGACACTACTCCCTATTTTGCGCTACCAGAAAATGCTATGGATTCA
AAGAAAAGAAAGAGGACGGATCCTAATTATGATCCTACTACTCTTTACGTACCTCCAGAG
TCGTTAAAGTAATTCACACCTGTTATGAGATAATACTGGGAAATTAAGTCTACTAATTTT
GATAAAATTCTTTTTTTTAAGCTAGGTAAATTCTATGAACTCTTTTACGAAGATGCCTTA
ATTACCCATAAAGAGTTAGATCTTAATTGGATGGGTAAAAAAATGCATACAGGTTTTCCT
GAAAAAGCTTTGGATAAAATGGCTTCTAAGCTAATTAGTTTAGGATATAAAGTAGCCGTA
GCTGAACAAACAGAAACTCCTGAGCAGATGAAATAGCGTTTAATGAGGGAAAAAAGTGGA
CCTAAGTGTGTTTCGAGAGAATTAGTATAGGTTATGACAAAAGGTACTTATGATTAAAAT
AACGAAACTGACTACCAGCCAAGATATTTAATGTCATTAAGAAATTTCTAAACAAAATTT
GGTATAATTATAGTTGAAAGTTCAACAAACGTTATAACTGTCGCTTACTTAAATGATGAC
ATACATTTTACACAATTTAAAACATTACTTTGTCAGGTTAAACCTTAAGAAATTGTTTAT
GATCCAGACAATATGACTCATGATATTAAAAAAATCATTTAATCAGGCTATTTAGCTCCT
TAATTATCTCCCCTTTAAAATAAAAATGATAACTGGAATAAAGGAATGGCTTATAATCAT
CTAGATAAAACACACGGTGATGTTCTAGAAGGCAAGTGGCCTAAATTGCTAAATAATTTG
TACAATACTGAAGAAACGAAGAGAGATCTTATATTTGAATCTATGGCAGGACTTTTTAAT
TATTTAAAATCTATTTTAATTTTAGATTAAGTTATTTCAGTTGCCAGATATCAAATTTAT
GATATTGAGAAGGGTGTTAGAAGCTGTATGATTTTAGACAGCTAGTCTCTATAGCACTTA
GAAATATTAGACTCTTCAAGCGGGCCAGTAAGCACTTAGAAAGAAAATTATAAGCTACAT
TTCGATGATGGATCACTACTTGGTTATATAAACAAAACAAAAACTCCATTTGGTTATAGA
ATGCTTAAGAATTGGATTTGTGCTCCTTTAATGGATATTAACAAAATTTATGATAGGTAT
GATGCTATTGAAGATCTTTAAAAGTTTAATTCTGAGAGAGATACCTTCCTCAGAGGTATT
GAAAAGCTTCCAGATCTTGAAAAAATGTGTGGTAGAATATACAAGTATTCCATCAGACAA
TAAAATTAAAATGTAGTTTATTTTGAAGATTTCTCATATTCTCGTTTAAAAGAGTTTAAA
GATTTAACAACTAAATTGGCAGAATCAGAAAAGCTCATTAAAACCCATCTTACTCCTTTT
GCTGACTAGTTTAAGAGTAAAAGACTGAGAAAATTGGTAACCCCAAACACCATTGACCAC
GAAGATGAAGAAGAGTATGAATTACCTGCTATGATTTACCATGGCTATTCAGATGAAGAA
GATGAGGTTGAAGAAAATATAAACTAGCATGCAGCAAAAGCAGAAAAGATGGAAATAGAA
AATAAACAAAGTAAAAAATCTAAAAGTTCTGGTTTACTTCCACCTGCTTCTAAATATATA
TAAGAATTCTAAAATTATATTGTCTGGTAAGGTCCTAAGGGCTAGGAAAAACCTTTACCT
AAAAAAGGGTTAGTTAATTCATATGATTTAGCCACAGAAGCTGTTTAGAATGTCGAGAAA
AAACTTTAAAATTACTTAGTTTAAATCTAATAGCAAATGAAAGACAAAACTATTAAATAT
GGCTTGAGATATGAATTAGAAATAAATGAAGATTTAGTTAAAGGAAATAAAAAACCTAAA
AACTTTGATTTCACAAGTAAAGCAGGCAAATATCAAAGATTCTAAACAAAAGAATTGCGT
GAACTCATAGCTGAGCTCGATGAAGCTGAAGATGTTCAAAAAAAAGAACTCAAAGAATTT
TGCAGATTCATTTTCAAAGAGTTCTATGAAAGCTATAAAACATGGGATACCTTAATTAAT
ATTCTTGCAGAATTAGATTGCTTAATAAGCTTAAGCAGAGTAAGTTTCTTGCTTGCTGAT
GGAGTTATGAGCAGACCTGAATTATATCCTGCTTCTGAAAAATATGTACCATTCATTGAG
TTAACCTCTGGAAGACATCCATGCTTAGCTTCGATGGGAGTTAACTTTATCCCTAACGAT
ATTTATCTTGGTGACATAAAATAGACAGGACAGTTTGAAGACAATAAGAACTTGATTCTT
TTAACAGGTCCTAACATGGGTGGTAAATCTACAACTTTGAGAATGGCTTGTGTAATGGCA
ATTTTAGCTTAAATTGGATGTTATGTACCTGCTAAATCTTTGAGAATGACATTGGTAGAT
CGTATATTCACTCGTATTGGTGCAAGTGATAAATTGATGGATGGAAAAAGTACTTTCTTC
ATTGAAATGGAAGAAACATCAAATGCAGTCAAGTAAGGTTCAAAGCATTCTTTGATTATT
ATGGATGAATTAGGAAGAGGTACTTCCACTTTTGATGGAGTTGCCATTGCATACTCTATA
GTAAGATACTTGGTAGAAAATTTACAAAGTCGTTGTTTATTTGCTACTCATTATCATGTA
TTACTTGATGAATTTAGACATTATCCATAAATAGCATATTATCACATGGCATGTCATGTT
GATGAGAAGAGAAGTAAAGTCATATTTTTATATAGATTAAAAGCAGGAGAATGTTCATCT
AGTTTTGGTATAAATGTTGCAAAGGTTGTTGGTATAAGCGATAATTTGATTGAAATTGCA
AAGTAAAAAGCTAAAGAATTTGAAGAAAATTTAAATATTTAGCATGCTTACAACACAAAT
AAGCGTTTTGGAATTTTGATGAAAGCAATCTAAGAATATGATAGAGATGAAAATTTGGAA
TAAATTATTGAATAATTTAATAAAGTTTAACTTTTATGA


>TTHERM_00194810(gene)
ATGAAGCAAAGTTCACTATTAAGCTTTTTTGGAAATGTGTAGAGAAGGAAAAGAGAAGAG
ATGGAGAAGGAATAGGCCTAAAACGATAATAAAATTGCTGAATCCACTCAAATTTCTTTA
TCTACATAAAAGAGCAATAAAGAAGTTAAGGAAATTTCTACTTGTGATGATACAGAAGTA
GCAAATTCAAGCGTTTAGGGTACCAGAAAAAGTAATTTAAAACGTCCTAAATTGGCAATA
GATTCTGATGAAGATGATGTTTTTAATCCAGAAGATTTAAAATAATTTTCTCATACTAGC
CCTTAGAAAAATAGCTAGAAAAAAGGAATAAGGTTTTAAAAAAATGATATGATTGATGAA
GATAATGATGATGAATCTTTTAAGGAAGATGATATAGAAGACATTGAAGATGAAGAAGAT
GATGATGATTTTATTGAAGATAGTGATGAAGAAGTTAAGCCTAAACGCAAACAAAAACAA
AGTTAGTAAAAAACACCTGTCAAGAAAACTGGTTCAGCTTCAAAAGGTAACAATTATCAT
AAATTTGAAATACTTAATATAAAATATTAATGATAAAGAAAATGATTTAGCAAGCCAATA
ATTTAATTTTTATAATTAAAAAGCAGGAGCAACAAAGAGTACTCCCAAATTTGGATAAGA
AAGTGCTAAAAAATCAGCAACTAAATAAAGTACAGCTAAAAAAGCAGAAGATGAGTTTAT
AAATTGTGATTAAGAAAATGATTTAGCAAGAGCTGCTGTAGATTAATTAGATGACACTAC
TCCCTATTTTGCGCTACCAGAAAATGCTATGGATTCAAAGAAAAGAAAGAGGACGGATCC
TAATTATGATCCTACTACTCTTTACGTACCTCCAGAGTCGTTAAAGTAATTCACACCTGT
TATGAGATAATACTGGGAAATTAAGTCTACTAATTTTGATAAAATTCTTTTTTTTAAGCT
AGGTAAAGAAAAAGATATAAAATATTTTGAGTTAGTAAGTAAGTGATATGTTATTTTTAA
AATCAAAATAGGTAAATTCTATGAACTCTTTTACGAAGATGCCTTAATTACCCATAAAGA
GTTAGATCTTAATTGGATGGGTAAAAAAATGCATACAGGTTTTCCTGAAAAAGCTTTGGA
TAAAATGGCTTCTAAGCTAATTAGTTTAGGATATAAAGTAGCCGTAGCTGAACAAACAGA
AACTCCTGAGCAGATGAAATAGCGTTTAATGAGGGAAAAAAGTGGACCTAAGTGTGTTTC
GAGAGAATTAGTATAGGTTATGACAAAAGGTACTTATGATTAAAATAACGAAACTGACTA
CCAGCCAAGATATTTAATGTCATTAAGAAATTTCTAAACAAAATTTGGTATAATTATAGT
TGAAAGTTCAACAAACGTTATAACTGTCGCTTACTTAAATGATGACATACATTTTACACA
ATTTAAAACATTACTTTGTCAGGTTAAACCTTAAGAAATTGTTTATGATCCAGACAATAT
GACTCATGATATTAAAAAAATCATTTAATCAGGCTATTTAGCTCCTTAATTATCTCCCCT
TTAAAATAAAAATGATAACTGGAATAAAGGAATGGCTTATAATCATCTAGATAAAACACA
CGGTGATGTTCTAGAAGGCAAGGTAAATTTAATAAATCATTTATTGACATTAAGTTATTG
ATATTAAACTAAATTAAATTAAAAGTGGCCTAAATTGCTAAATAATTTGTACAATACTGA
AGAAACGAAGAGAGATCTTATATTTGAATCTATGGCAGGACTTTTTAATTATTTAAAATC
TATTTTAATTTTAGATTAAGTTATTTCAGTTGCCAGATATCAAATTTATGATATTGAGAA
GGGTGTTAGAAGCTGTATGATTTTAGACAGCTAGTCTCTATAGCACTTAGAAATATTAGA
CTCTTCAAGCGGGCCAGTAAGCACTTAGAAAGAAAATTATAAGCTACATTTCGATGATGG
ATCACTACTTGGTTATATAAACAAAACAAAAACTCCATTTGGTTATAGAATGCTTAAGAA
TTGGATTTGTGCTCCTTTAATGGATATTAACAAAATTTATGATAGGTATGATGCTATTGA
AGATCTTTAAAAGTTTAATTCTGAGAGAGATACCTTCCTCAGAGGTATTGAAAAGCTTCC
AGATCTTGAAAAAATGTGTGGTAGAATATACAAGTATTCCATCAGACAATAAAATTAAAA
TGTAGTTTATTTTGAAGATTTCTCATATTCTCGTTTAAAAGAGTTTAAAGATTTAACAAC
TAAATTGGCAGAATCAGAAAAGCTCATTAAAACCCATCTTACTCCTTTTGCTGACTAGTT
TAAGAGTAAAAGACTGAGAAAATTGGTAACCCCAAACACCATTGACCACGAAGATGAAGA
AGAGTATGAATTACCTGCTATGATTTACCATGGCTATTCAGATGAAGAAGATGAGGTTGA
AGAAAATATAAACTAGCATGCAGCAAAAGCAGAAAAGATGGAAATAGAAAATAAACAAAG
TAAAAAATCTAAAAGTTCTGGTTTACTTCCACCTGCTTCTAAATATATATAAGAATTCTA
AAATTATATTGTCTGGTAAGGTCCTAAGGGCTAGGAAAAACCTTTACCTAAAAAAGGGTT
AGTTAATTCATATGATTTAGCCACAGAAGCTGTTTAGAATGTCGAGAAAAAACTTTAAAA
TTACTTAGTTTAAATCTAATAGCAAATGAAAGACAAAACTATTAAATATGGCTTGAGATA
TGAATTAGAAATAAATGAAGATTTAGTTAAAGGAAATAAAAAACCTAAAAACTTTGATTT
CACAAGTAAAGCAGGCAAATATCAAAGATTCTAAACAAAAGAATTGCGTGAACTCATAGG
TAAATAAAAAATTTAATTTTTATTAAGTAAATTTTAAAACAATTTTTAAATTAGCTGAGC
TCGATGAAGCTGAAGATGTTCAAAAAAAAGAACTCAAAGAATTTTGCAGATTCATTTTCA
AAGAGTTCTATGAAAGCTATAAAACATGGGATACCTTAATTAATATTCTTGCAGAATTAG
ATTGCTTAATAAGCTTAAGCAGAGTAAGTTTCTTGCTTGCTGATGGAGTTATGAGCAGAC
CTGAATTATATCCTGCTTCTGAAAAATATGTACCATTCATTGAGTTAACCTCTGGAAGAC
ATCCATGCTTAGCTTCGATGGGAGTTAACTTTATCCCTAACGATATTTATCTTGGTGACA
TAAAATAGACAGGACAGTTTGAAGACAATAAGAACTTGATTCTTTTAACAGGTCCTAACA
TGGGTGGTAAATCTACAACTTTGAGAATGGCTTGTGTAATGGCAATTTTAGCTTAAATTG
GATGTTATGTACCTGCTAAATCTTTGAGAATGACATTGGTAGATCGTATATTCACTCGTA
TTGGTGCAAGTGATAAATTGATGGATGGAAAAAGTACTTTCTTCATTGAAATGGAAGAAA
CATCAAATGCAGTCAAGTAAGGTTCAAAGCATTCTTTGATTATTATGGATGAATTAGGAA
GAGGTACTTCCACTTTTGATGGAGTTGCCATTGCATACTCTATAGTAAGATACTTGGTAG
AAAATTTACAAAGTCGTTGTTTATTTGCTACTCATTATCATGTATTACTTGATGAATTTA
GACATTATCCATAAATAGCATATTATCACATGGCATGTCATGTTGATGAGAAGAGAAGTA
AAGTCATATTTTTATATAGATTAAAAGCAGGAGAATGTTCATCTAGTTTTGGTATAAATG
TTGCAAAGGTAATTTAATAATTTTATTTCACTTCTAAATTATTAATTCTATTAAATAAAT
TAATAAAACAGGTTGTTGGTATAAGCGATAATTTGATTGAAATTGCAAAGTAAAAAGCTA
AAGAATTTGAAGAAAATTTAAATATTTAGCATGCTTACAACACAAATAAGCGTTTTGGAA
TTTTGATGAAAGCAATCTAAGAATATGATAGAGATGAAAATTTGGAATAAATTATTGAAT
AATTTAATAAAGTTTAACTTTTATGA


>TTHERM_00194810(protein)
MKQSSLLSFFGNVQRRKREEMEKEQAQNDNKIAESTQISLSTQKSNKEVKEISTCDDTEV
ANSSVQGTRKSNLKRPKLAIDSDEDDVFNPEDLKQFSHTSPQKNSQKKGIRFQKNDMIDE
DNDDESFKEDDIEDIEDEEDDDDFIEDSDEEVKPKRKQKQSQQKTPVKKTGSASKAGATK
STPKFGQESAKKSATKQSTAKKAEDEFINCDQENDLARAAVDQLDDTTPYFALPENAMDS
KKRKRTDPNYDPTTLYVPPESLKQFTPVMRQYWEIKSTNFDKILFFKLGKFYELFYEDAL
ITHKELDLNWMGKKMHTGFPEKALDKMASKLISLGYKVAVAEQTETPEQMKQRLMREKSG
PKCVSRELVQVMTKGTYDQNNETDYQPRYLMSLRNFQTKFGIIIVESSTNVITVAYLNDD
IHFTQFKTLLCQVKPQEIVYDPDNMTHDIKKIIQSGYLAPQLSPLQNKNDNWNKGMAYNH
LDKTHGDVLEGKWPKLLNNLYNTEETKRDLIFESMAGLFNYLKSILILDQVISVARYQIY
DIEKGVRSCMILDSQSLQHLEILDSSSGPVSTQKENYKLHFDDGSLLGYINKTKTPFGYR
MLKNWICAPLMDINKIYDRYDAIEDLQKFNSERDTFLRGIEKLPDLEKMCGRIYKYSIRQ
QNQNVVYFEDFSYSRLKEFKDLTTKLAESEKLIKTHLTPFADQFKSKRLRKLVTPNTIDH
EDEEEYELPAMIYHGYSDEEDEVEENINQHAAKAEKMEIENKQSKKSKSSGLLPPASKYI
QEFQNYIVWQGPKGQEKPLPKKGLVNSYDLATEAVQNVEKKLQNYLVQIQQQMKDKTIKY
GLRYELEINEDLVKGNKKPKNFDFTSKAGKYQRFQTKELRELIAELDEAEDVQKKELKEF
CRFIFKEFYESYKTWDTLINILAELDCLISLSRVSFLLADGVMSRPELYPASEKYVPFIE
LTSGRHPCLASMGVNFIPNDIYLGDIKQTGQFEDNKNLILLTGPNMGGKSTTLRMACVMA
ILAQIGCYVPAKSLRMTLVDRIFTRIGASDKLMDGKSTFFIEMEETSNAVKQGSKHSLII
MDELGRGTSTFDGVAIAYSIVRYLVENLQSRCLFATHYHVLLDEFRHYPQIAYYHMACHV
DEKRSKVIFLYRLKAGECSSSFGINVAKVVGISDNLIEIAKQKAKEFEENLNIQHAYNTN
KRFGILMKAIQEYDRDENLEQIIEQFNKVQLL