Identifiers and Description

Gene Model Identifier

TTHERM_00408780

Standard Name

TTLL14E (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt21494 | 44.m00161 | 3714.m00009

Description

TTLL14E tubulin-tyrosine ligase family protein; Similar to tubulin tyrosine ligase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( TIGR00166 ) ribosomal protein S6
  • ( TIGR01607 ) Plasmodium subtelomeric family (PST-A)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10278.1 9.997093137033517e-262
Description: tubulin-tyrosine ligase (1215 aa)
Oxytricha Contig16201.0.g99 3.000328303707556e-126
Description: Tubulin-tyrosine ligase family
Stentor Coeruleus SteCoe_26218 1.0377033238158346e-53
Description: None
WormBase WBGene00014232 6.002718307283067e-26
Description: locus:ttll-4 Tubulin polyglutamylase ttll-4 status:Partially_confirmed UniProt:Q09647 protein_id:CAA87425.3
DictyBase DDB_G0281541 1.0002869940498747e-21
Description: DDB_G0281541 on chromosome: 3 position 4627625 to 4629265
SGD YBR094W 9.997764199084386e-16
Description: PBY1 Putative tubulin tyrosine ligase associated with P-bodies

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00408780(coding)
ATGATTAGAAATAACCAAAATTTAGCACCTTAAGCTGGCTAAGTTACAGGTTAAATCAAT
AGCCCCTTAATTGAAAAGTTATAAAAATTTTAGCAGAAGTATCAACAAATATTAGAACAC
TAAAATCCTATCACTCAATTAATTTAGAAGTCTAATGCTAATTCATTTACTATCATAAAT
AAATAATAGAATTCCGACTTTGAAGATAAATAAATTTATACTAGGCGCTAAGCGAATCCA
CATTAATCCTACATAGCACAATCAAAAAAAAATATTCTAGAAAAGCAATATAATTAACTC
TATTTGTAAAAACTACAGTAAAACCACACTCAGATATAAAATTAGCAATAAATTTAGCTA
GAAAATGCTCTTCTTAAATCATAGGTCAATCCAAGTATTACTGAGTATTCAGCACAAAAG
TCAAATAACTAACCACACGTTAAAGGAAATCAAATATTAGCGGACTACAATACCCTCCAC
ATTTAATAATTTGAAGATAAATTAAATGACTACGTAAATGAGAGAAATCGAATTTATTAG
TAGATATACAAGAATTAAAATACTGAAAATAAAGACAGTACTTCGATAAACAGGCCTAGT
GCGAGATAATATAATATTGTTAATCTAAATAAGATTAACTTAAGTAATGAAAGGTACTGC
GAAATTGAAGCTTATCTTGAAAATTCATAGACAGTTCCAACTTAATAAAACCACTCTAAT
GCAAATGCTATCTTACCCATTTAGCAGTAGCAGAAAAACCATTCAGTGATTTAACAAGTG
ATTAAAAAATAGCTATAAGGTGGTTAAAGAATAGTTAAATTCAATAAGAAGAGAAGAGAA
ATAAAACCTTCCAATCTTTTAGGTGGTGATTATTTTATGTTTTTGGATGCAAAAAGGTAA
GGCCACTTGAAATCTCTTAAAGACTGTGATGAAGATGTTCTCTATAGGATTTGGCAGCTT
CAAGAAAAAGGAATTGTTGTTAATGAATCGGAATTAATGGCAGTATCATGTGGAGAGTCT
ATACAGTTGGTCACTTAAAAATAACATGCCTTCTAGAGATAACCTCATTACAATAAAAGA
GTTAACGTTCAGTCATTGATTGGCTAAAATACCATATCTAAGAGTGGTATAGATGAAACT
CAAATGAATTTGTCAATATCTCCTTCGAGTAATGTGGTTTCTTACCCAACTTAATAATAT
TATTCTGCTAACTACTAATATTAAAATTCTAATAATGCTGATTAGATTATGATTGATGAT
TAGTTATCAAATAAAAAGTAGATTGAACAAAATTTAATGATCTCTAGTCTTAATTATAAC
TAAAAAGATTTTAAAAATAATAATGAATACAGGCTTGTCAGAGCAAAAGATGATTATGAT
AAAGAAAGCATATAGCAAATGTTTTAACCTTTTAATTCACCCACTAACAGGCCAATGAGC
AGTTCGATACAAAATAAGAGGATTGTAAATGGGCTTCCTCTCGTTTCAGGGAATTAAATT
TTGACTAATTATAATCAGCTGAGATACATGAATAACATCTAAAAGACATAAAATTAAAAA
AATGAACCTCCAAAGAAAATTTCTTATAATTTAGGAATTATTCAGTAGGCTCTTAATGAA
GGTACTTAGCCCTCTGCTACAATAACATAAAAAATGATAATAAAACATACTCCTAGGATA
AATTCTCGACCTGTTTCGAATTATGAGCAAACTGCAAGTGGAATCGCAGTTGCTTAAAAT
ACAATCAGCTAAAATAATCAATAAAATGATAAATAATTTAAAAGAAAAAGCATTAAAAAC
ACAAATAATTCTCCGAAAAACTAAGTTGTTTCAACTAAATAGCAGATACTATAATAAAAA
ATGGAAAATTATAGAGATTTCATAAATATCCTCAATTACTCTAACAACTTAATTATTCCT
TACAACTTATCAAATCCTAATCCACCTTTATACAAAGTATATATTGGATTGGGTAATAAT
GGAATTTTAGTTAGATAGATTTTTAAATCAAGGTGGTGGTGGTAGCTAGTCGAAAGCCAT
GATGACTGGCCTGATTGCTAATTTTTGTGGATGTAGTGGAGAAGGAAAGAGTATACAAAG
TATATGAAGTCTCTTCCACAGCTCACATATGAAAAATAGCTAATCAAGAATGTTGAAAAC
AAAGGAGAGGATGAAAGTAAACCTACTTTAAAAAAGAAGATGACAATTGAGCAGTCCAAG
AAAAAAGGAGAATCTTATTAAAAACTGGTTTAAAAGCTTATTAATGAATCAGATTTTGAT
TCTTTGGAGAATTATTTAATGTAAAATAAGAAAATATTTGCACCTCCATTCATATCTAAA
GATTTTTGTAGCGAGAAATACTGTGAAGAGCAAAGTAAAAATAGAACTTTTACAAAATTA
AAAGATCCCATAAATTATAAGCTTCATAATCATGTTTAAAATAACTTTCACATTTGCAAT
AAAAAAGCATTATTCTATAATATGAGATAATATTATGAATGTATATAAAAAAATCCATTT
GATTACATTCCTCTAACATTTCATATTAAGGAGGGTACGAGTGATCAAGAATGGGAGAAG
TTTTTAACTTTCTATAATTAAATTGAAGGATAAATGCAAGAAAATGAGAAGCTTAGGTAG
AAAATAGATGCTGAGAAGCTCAATATTGAAAAGCCTAAATAAATTAAGAATGTTTGGATA
ATCAAGCCAGGTGAGGCTACAAACAGGGGAAATGGAATCCAAGTTGCATCAGATTTGTAG
TCTATATAAAATATAGTTAACACTAAAGAAATGCATAATAATGGCAAGAAAAAAACATTT
ATCATACAGAAATACCTTGAAAAACCTCTGCTATACAACAAGAGAAAGTTTGATATTAGA
TGCTATATGCTCATAACAACCTATAACGGTATCATAAAAGGATATTGGTATCAAGAAGGA
TATATAAGAACTAGTTCAAAAGAATTTACTTTAAGAAATCTAGATAACAAATTTATTCAT
TTGACTAACGACGCAATTCAAAAAAAAGGGGAAGAATTCGGAAAATTTGAAATTGGAAAT
AAACTTTCTTTTAATGAATTTTAGAGGTATATGGATACTATAAACAGTTCTAGTTAAGTT
AAATATAACTTTATGGAGAAAACCTATCAAGATATGAAAGGTGTTGCAACAGATTGTGTC
AAAGCAATTTTCAAGAAGCTTGAGCCTTAAAAAAAATAATTCAGTTTTGAACTATTTGGT
TTAGATTTTATGATTGACGATAGCTATAAGACATGGCTGATTGAAGTAAATACAAATCCT
TGTTTAGAAACCAGCTGCCCACTTCTAGCTAGAATCATATCCACTCTTGTTGAAAATGTA
TTTAAAGTTGCAGTTGATCCAATCTTCCCCCCTCCTAATTTCCCTAAGAGTAAAAAGCAC
TTAATCCCAGAAAATATTTTTGAGTCTAATAAATTTGAATTAATATTCGATGAACTTCAA
GACGCTTAATAACTCTCTACCCTTCCTTCTAAAAGTGATTATGATGACTTTTTAGAAGAA
GACTGTGAAGAAGAAGAACAGCTACTAGCAGAAGAAGAAAGTGAGTGA


>TTHERM_00408780(gene)
ATGATTAGAAATAACCAAAATTTAGCACCTTAAGCTGGCTAAGTTACAGGTTAAATCAAT
AGCCCCTTAATTGAAAAGTTATAAAAATTTTAGCAGAAGTATCAACAAATATTAGAACAC
TAAAATCCTATCACTCAATTAATTTAGAAGTCTAATGCTAATTCATTTACTATCATAAAT
AAATGTAATACTACTTTACTTTAAAGCTAATGCTTCAATAGATGTTTATATGTTTTATCG
CTCCTTATTTTTATATTTATTAGAAATATCTTTTAAATAGAATAGAATTCCGACTTTGAA
GATAAATAAATTTATACTAGGCGCTAAGCGAATCCACATTAATCCTACATAGCACAATCA
AAAAAAAATATTCTAGAAAAGCAATATAATTAACTCTATTTGTAAAAACTACAGTAAAAC
CACACTCAGATATAAAATTAGCAATAAATTTAGCTAGAAAATGCTCTTCTTAAATCATAG
GTCAATCCAAGTATTACTGAGTATTCAGCACAAAAGTCAAATAACTAACCACACGTTAAA
GGTATAACCAAGATAAGTTAATTTATTTTAAGGAGAAAAAAATGCAAATAAATCCAATCA
ATAACAAGCATAAAGAATTTCTCAGTTTAAATTTTTAAAAAGAGGAAATGCGTTTAAATG
GTTAAAATGAATTTATAAGTTTTTTCTTGAACGATTTCGTTTTGTTTTAAGAATTGTGAA
AAGTATTTATTTGCAAAATGTTTTGTTATTTTTGACAAAAAAATAGGAAATCAAATATTA
GCGGACTACAATACCCTCCACATTTAATAATTTGAAGATAAATTAAATGACTACGTAAAT
GAGAGAAATCGAATTTATTAGTAGATATACAAGAATTAAAATACTGAAAATAAAGACAGT
AGTAATTCTTTCTCATATTTTCCTATTATTTTTTTTTTTCTTACTAAATTCTTGTTGTAA
CTTAATTTCTAAATTACTTTTCAAATAAGTTACTAGTAACTGAGTGAATGAATGAACAAT
TAAGTGCAATCAAATATTCATTCTTATTATTTTGCAAATCTTCCATTAAAAGATTCAACA
AATTTTTACAAAAAAACAACAGAAGCTTATTTTCCATTTACTTAATTTTACCTACTATGT
TTACCTATCTAAATCATCATTTTGTAATAAAAATTTAATGTAAATATTTAAAGCTTCGAT
AAACAGGCCTAGTGCGAGATAATATAATATTGTTAATCTAAATAAGATTAACTTAAGTAA
TGAAAGGTACTGCGAAATTGAAGCTTATCTTGAAAATTCATAGACAGTTCCAACTTAATA
AAACCACTCTAATGCAAATGCTATCTTACCCATTTAGCAGTAGCAGAAAAACCATTCAGT
GATTTAACAAGTGATTAAAAAATAGCTATAAGGTGGTTAAAGAATAGTTAAATTCAATAA
GAAGAGAAGAGAAATAAAACCTTCCAATCTTTTAGGTGGTGATTATTTTATGTTTTTGGA
TGCAAAAAGGTAAGGCCACTTGAAATCTCTTAAAGACTGTGATGAAGATGTTCTCTATAG
GATTTGGCAGCTTCAAGAAAAAGGAATTGTTGTTAATGAATGTATCCATTTTTTATTATG
TTTTTAATTCAATATATATATATAGAATTTTTTTAATTTAAGCGGAATTAATGGCAGTAT
CATGTGGAGAGTCTATACAGTTGGTCACTTAAAAATAACATGCCTTCTAGAGATAACCTC
ATTACAATAAAAGAGTTAACGTTCAGTCATTGATTGGCTAAAATACCATATCTAAGAGTG
GTATAGATGAAACTCAAATGAATTTGTCAATATCTCCTTCGAGTAATGTGGTTTCTTACC
CAACTTAATAATATTATTCTGCTAACTACTAATATTAAAATTCTAATAATGCTGATTAGA
TTATGATTGATGATTAGTTATCAAATAAAAAGTAGATTGAACAAAATTTAATGATCTCTA
GTCTTAATTATAACTAAAAAGATTTTAAAAATAATAATGAATACAGGCTTGTCAGAGCAA
AAGATGATTATGATAAAGAAAGCATATAGCAAATGTTTTAACCTTTTAATTCACCCACTA
ACAGGCCAATGAGCAGTTCGATACAAAATAAGAGGATTGTAAATGGGCTTCCTCTCGTTT
CAGGGAATTAAATTTTGACTAATTATAATCAGCTGAGATACATGAATAACATCTAAAAGA
CATAAAATTAAAAAAATGAACCTCCAAAGAAAATTTCTTATAATTTAGGAATTATTCAGT
AGGCTCTTAATGAAGGTACTTAGCCCTCTGCTACAATAACATAAAAAATGATAATAAAAC
ATACTCCTAGGATAAATTCTCGACCTGTTTCGAATTATGAGCAAACTGCAAGTGGAATCG
CAGTTGCTTAAAATACAATCAGCTAAAATAATCAATAAAATGATAAATAATTTAAAAGAA
AAAGCATTAAAAACACAAATAATTCTCCGAAAAACTAAGTTGTTTCAACTAAATAGCAGA
TACTATAATAAAAAATGGAAAATTATAGAGATTTCATAAATATCCTCAATTACTCTAACA
ACTTAATTATTCCTTACAACTTATCAAATCCTAATCCACCTTTATACAAAGTATATATTG
GATTGGGTAATAATGGAATTTTAGTTAGATAGATTTTTAAATCAAGGTATTTTTTTATTT
TTAAACAATTTCTAATTAGAATTTTAATTTTGTTAGGTGGTGGTGGTAGCTAGTCGAAAG
CCATGATGACTGGCCTGATTGCTAATTTTTGTGGATGTAGTGGAGAAGGAAAGAGTATAC
AAAGTATATGAAGTCTCTTCCACAGCTCACATATGAAAAATAGCTAATCAAGAATGTTGA
AAACAAAGGAGAGGATGAAAGTAAACCTACTTTAAAAAAGAAGATGACAATTGAGCAGTC
CAAGAAAAAAGGAGAATCTTATTAAAAACTGGTTTAAAAGCTTATTAATGAATCAGATTT
TGATTCTTTGGAGAATTATTTAATGTAAAATAAGGTAAAATATTTATTTAAATGATTAAA
TTTTTATCAATTTTAATTAATATTTAAGAAAATATTTGCACCTCCATTCATATCTAAAGA
TTTTTGTAGCGAGAAATACTGTGAAGAGCAAAGTAAAAATAGAACTTTTACAAAATTAAA
AGATCCCATAAATTATAAGCTTCATAATCATGTTTAAAATAACTTTCACATTTGCAATAA
AAAAGTATGATAAAATTTTGTATTTTTCATTAACCATCAAATTTTCACTTTATTAATTCT
AGGCATTATTCTATAATATGAGATAATATTATGAATGTATATAAAAAAATCCATTTGATT
ACATTCCTCTAACATTTCATATTAAGGAGGGTACGAGTGATCAAGAATGGGAGAAGTTTT
TAACTTTCTATAATTAAATTGAAGGATAAATGCAAGAAAATGAGAAGCTTAGGTAGAAAA
TAGATGCTGAGAAGCTCAATATTGAAAAGCCTAAATAAATTAAGAATGTTTGGATAATCA
AGCCAGGTGAGGCTACAAACAGGGGAAATGGAATCCAAGGTAAAATTAATATTTTGAAAA
ATAATAATCAGTATCAATCAATTATTTTAATTAAAATAAATAGTTGCATCAGATTTGTAG
TCTATATAAAATATAGTTAACACTAAAGAAATGCATAATAATGGCAAGAAAAAAACATTT
ATCATACAGAAATACCTTGAAAAACCTCTGCTATACAACAAGAGAAAGTTTGATATTAGA
TGCTATATGCTCATAACAACCTATAACGGTATCATAAAAGGTAGAGATATATTAGTTTAT
TAAATGTGAATGATAGTTTTTTTTAATTTATCTATTTAGGATATTGGTATCAAGAAGGAT
ATATAAGAACTAGTTCAAAAGAATTTACTTTAAGAAATCTAGATAACAAATTTATTCATT
TGACTAACGACGCAATTCAAAAAAAAGGGGAAGAATTCGGAAAATTTGAAATTGGAAATA
AACTTTCTTTTAATGAATTTTAGAGGTATATGGATACTATAAACAGTTCTAGTTAAGTTA
AATATAACTTTATGGAGAAAACCTATCAAGATATGAAAGTAAATTAATTAATTAATATTT
TTCACTCTAAATATTTTAATTAAATAACATAGGGTGTTGCAACAGATTGTGTCAAAGCAA
TTTTCAAGAAGCTTGAGCCTTAAAAAAAATAATTCAGTTTTGAAGTAAATTAAATTGAGA
ATATTTATAGATATATAAATCCTTTAATTTTATAAATTTAGCTATTTGGTTTAGATTTTA
TGATTGACGATAGCTATAAGACATGGCTGATTGAAGTAAATACAAATCCTTGTTTAGAAA
CCAGCTGCCCACTTCTAGCTAGAATCATATCCACTCTTGTTGAAAATGTATTTAAAGTTG
CAGTTGATCCAATCTTCCCCCCTCCTAATTTCCCTAAGAGTAAAAAGCACTTAATCCCAG
AAAATATTTTTGAGTCTAATAAATTTGAATTAATATTCGATGAACTTCAAGACGCTTAAT
AACTCTCTACCCTTCCTTCTAAAAGTGATTGTAATAAAATTATCATTTTTTTACTTTACA
TGCAAATAATTAAATATCAATTAATAAATAAAAAGATGATGACTTTTTAGAAGAAGACTG
TGAAGAAGAAGAACAGCTACTAGCAGAAGAAGAAAGTGAGTGA


>TTHERM_00408780(protein)
MIRNNQNLAPQAGQVTGQINSPLIEKLQKFQQKYQQILEHQNPITQLIQKSNANSFTIIN
KQQNSDFEDKQIYTRRQANPHQSYIAQSKKNILEKQYNQLYLQKLQQNHTQIQNQQQIQL
ENALLKSQVNPSITEYSAQKSNNQPHVKGNQILADYNTLHIQQFEDKLNDYVNERNRIYQ
QIYKNQNTENKDSTSINRPSARQYNIVNLNKINLSNERYCEIEAYLENSQTVPTQQNHSN
ANAILPIQQQQKNHSVIQQVIKKQLQGGQRIVKFNKKRREIKPSNLLGGDYFMFLDAKRQ
GHLKSLKDCDEDVLYRIWQLQEKGIVVNESELMAVSCGESIQLVTQKQHAFQRQPHYNKR
VNVQSLIGQNTISKSGIDETQMNLSISPSSNVVSYPTQQYYSANYQYQNSNNADQIMIDD
QLSNKKQIEQNLMISSLNYNQKDFKNNNEYRLVRAKDDYDKESIQQMFQPFNSPTNRPMS
SSIQNKRIVNGLPLVSGNQILTNYNQLRYMNNIQKTQNQKNEPPKKISYNLGIIQQALNE
GTQPSATITQKMIIKHTPRINSRPVSNYEQTASGIAVAQNTISQNNQQNDKQFKRKSIKN
TNNSPKNQVVSTKQQILQQKMENYRDFINILNYSNNLIIPYNLSNPNPPLYKVYIGLGNN
GILVRQIFKSRWWWQLVESHDDWPDCQFLWMQWRRKEYTKYMKSLPQLTYEKQLIKNVEN
KGEDESKPTLKKKMTIEQSKKKGESYQKLVQKLINESDFDSLENYLMQNKKIFAPPFISK
DFCSEKYCEEQSKNRTFTKLKDPINYKLHNHVQNNFHICNKKALFYNMRQYYECIQKNPF
DYIPLTFHIKEGTSDQEWEKFLTFYNQIEGQMQENEKLRQKIDAEKLNIEKPKQIKNVWI
IKPGEATNRGNGIQVASDLQSIQNIVNTKEMHNNGKKKTFIIQKYLEKPLLYNKRKFDIR
CYMLITTYNGIIKGYWYQEGYIRTSSKEFTLRNLDNKFIHLTNDAIQKKGEEFGKFEIGN
KLSFNEFQRYMDTINSSSQVKYNFMEKTYQDMKGVATDCVKAIFKKLEPQKKQFSFELFG
LDFMIDDSYKTWLIEVNTNPCLETSCPLLARIISTLVENVFKVAVDPIFPPPNFPKSKKH
LIPENIFESNKFELIFDELQDAQQLSTLPSKSDYDDFLEEDCEEEEQLLAEEESE