Identifiers and Description

Gene Model Identifier

TTHERM_00790790

Standard Name

HTA1 (Histone h Two A 1)

Aliases

PreTt01369 | 133.m00094

Description

HTA1 histone H2A; Histone H2A; one of four histones (H2A- H2B- H3 and H4) that comprise nucleosome core; one of two major histone H2A genes (with HTA2); knockout viable- but double knockout with HTA2 inviable

Genome Browser (Macronucleus)

Full Screen View


Genome Browser (Micronucleus)

Full Screen View

External Links

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

  • ( SD01390 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes
  • ( SD01391 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes
  • ( SD01392 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes
  • ( SD01393 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes
  • ( SD01394 ) Micronucleus: Neo2 cassette knockout of HTAX coding region
  • ( SD01395 ) Micronucleus: Neo2 cassette knockout of HTAX coding region
  • ( SD01903 ) Macronucleus: HTAX has mutation S134A with neo2 cassette in 3’ flank
  • ( SD01904 ) Macronucleus: HTAX has mutation S134A with neo2 cassette in 3’ flank
  • ( SD01940 ) Macronucleus: HTA1 with neo2 cassette in 3’ flank
  • ( SD01941 ) Macronucleus: HTA1 with neo2 cassette in 3’ flank
  • ( SD02059 ) Micronucleus: neo2 replaces coding of HTAX, HTA1, HTB1,HTB2
  • ( SD02060 ) Micronucleus: neo2 replaces coding of HTAX,HTA1,HTB1,HTB2
  • ( SD02134 ) Macronucleus: hta1 with deletion and neo2
  • ( SD02135 )
  • ( SD02136 )
  • ( SD02164 ) Micronucleus: neo2 of HTAX,HTA1,HTB1,HTB2 Macronucleus: HTAX with K123R and HTB1 with K115R, neo2 of HTA1,HTB2
  • ( SD02165 ) Micronucleus: neo2 of HTAX,HTA1,HTB1,HTB2 Macronucleus: HTAX with K123R and HTB1 with K115R, neo2 of HTA1,HTB2
  • ( SD02166 ) Micronucleus: neo2 of HTAX,HTA1,HTB1,HTB2 Macronucleus: WT HTAX and HTB1, neo2 of HTA1,HTB2
  • ( SD02167 ) Micronucleus: neo2 of HTAX,HTA1,HTB1,HTB2 Macronucleus: WT HTAX and HTB1, neo2 of HTA1,HTB2
  • ( SD02168 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes Macronucleus: WT HTAX
  • ( SD02169 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes Macronucleus: WT HTAX
  • ( SD02170 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes Macronucleus: WT HTAX
  • ( SD02198 ) Micronucleus: HTAX and HTA1 KO with neo Macronucleus: Rescue with mutated HTAX with S1P,,K5R,K8R,K10R, K12R,K17R, S122A, k123R, S124A, K125R, K126R, T127A, S129A
  • ( SD02199 ) Micronucleus: HTAX and HTA1 KO with neo Macronucleus: Rescue with mutated HTAX with S1P,,K5R,K8R,K10R, K12R,K17R, S122A, k123R, S124A, K125R, K126R, T127A, S129A
  • ( SD02280 ) Macronucleus: HTA1 with neo2 cassette in 3' flank
  • ( SD02281 ) Macronucleus: HTA1 with neo2 cassette in 3' flank
  • ( SD02282 ) Macronucleus: HTAX has mutation S134A with neo2 cassette in 3' flank
  • ( SD02283 ) Macronucleus: HTAX has mutation S134A with neo2 cassette in 3' flank
  • ( SD02383 ) Micronucleus: Neo2 replace HTAX coding Macronucleus: Neo2 replace HTAX coding
  • ( SD02384 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02385 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02387 ) Micronucleus: KO of HTAX and HTA1 with neo2 Macronucleus: Complete KO of HTA1 with neo2, Partial replacement of HTAX with neo2
  • ( SD02388 ) Micronucleus: KO of HTAX and HTA1 with neo2 Macronucleus: Complete KO of HTA1 with neo2, Partial replacement of HTAX with neo2
  • ( SD02389 ) Micronucleus: KO of HTAX and HTA1 with neo2 Macronucleus: Complete KO of HTA1 with neo2, Partial replacement of HTAX with neo2
  • ( SD02390 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02391 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02392 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02393 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02394 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes Macronucleus: WT HTAX
  • ( SD02395 ) Micronucleus: Neo 2 knockout of HTAX and HTA1 genes Macronucleus: WT HTAX
  • ( SD02396 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02397 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02399 ) Micronucleus: Neo2 KO of HTAX and HTA1 Macronucleus: Neo2 KO of HTA1, partial KO of HTAX some HTAX has K123R mutation
  • ( SD02400 ) Micronucleus: Neo2 KO of HTAX and HTA1 Macronucleus: Neo2 KO of HTA1, partial KO of HTAX some HTAX has K123R mutation
  • ( SD02401 ) Micronucleus: Neo2 KO of HTAX and HTA1 Macronucleus: Neo2 KO of HTA1, partial KO of HTAX some HTAX has K123R mutation
  • ( SD02402 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ Macronucleus: mutant HTAX and HTAZ rescue of mac KO
  • ( SD02403 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ Macronucleus: mutant HTAX and HTAZ rescue of mac KO
  • ( SD02451 ) Micronucleus: Neo2 knockout of HTAX,HTA1,HTAZ Macronucleus: WT HTAX and HTAZ rescue of mac
  • ( SD02452 ) Micronucleus: Neo2 knockout of HTAX,HTA1,HTAZ Macronucleus: WT HTAX and HTAZ rescue of mac KO
  • ( SD02626 ) Micronucleus: neo2 replaces coding of HTAX,HTA1,HTB1,HTB2
  • ( SD02627 ) Micronucleus: neo2 replaces coding of HTAX,HTA1,HTB1,HTB2
  • ( SD02628 ) Micronucleus: neo2 replaces coding of HTAX,HTA1,HTB1,HTB2
  • ( SD02629 ) Micronucleus: Neo2 knockout of HTAX,HTA1,HTB1,HTB2
  • ( SD02630 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ
  • ( SD02631 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ
  • ( SD02632 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ
  • ( SD02633 ) Micronucleus: Neo2 knockout of HTAX, HTA1, HTAZ
  • ( SD02671 ) Micronucleus: Neo2 cassette knockout of HTAX coding region
  • ( SD02702 ) Macronucleus: Tap tagged HTAX into MTT1 locus
  • ( SD02810 ) Micronucleus: Neo 2 knockout of HTA1 and HTA2 genes Macronucleus: mutated HTA1
  • ( SD02811 )
  • ( SD02812 ) Micronucleus: Neo2 cassette knockout of HTAX coding region
  • ( SD02813 )
  • ( SD02872 ) Macronucleus: neo2 into HTA1
  • ( SD02876 ) Macronucleus: neo2 into HTA1
  • ( SD02877 )
  • ( SD02878 )
  • ( SD02879 )
  • ( SD02880 ) Macronucleus: neo2 into HTA1

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05608.1 1.0001689416974253e-96
Description: core histone H2A/H2B/H3/H4 family protein (139 aa)
Oxytricha Contig22612.0.g35 5.9981191891941984e-64
Description: Core histone H2A/H2B/H3/H4
SGD YBL003C 9.997652352281279e-57
Description: HTA2 Histone H2A, core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p
WormBase WBGene00001909 9.995951036711152e-55
Description: locus:his-35 Histone H2A status:Confirmed UniProt:Q27485 protein_id:CAA94747.1
DictyBase DDB_G0279667 1.0004783691736523e-35
Description: H2AX on chromosome: 3 position 2410613 to 2411077
Stentor Coeruleus SteCoe_25962 2.1705220113036395e-29
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):
  2. Ref:17242195: Song X, Gjoneska E, Ren Q, Taverna SD, Allis CD, Gorovsky MA (2007) Phosphorylation of the SQ H2A.X motif is required for proper meiosis and mitosis in Tetrahymena thermophila. Molecular and cellular biology 27(7):2648-60
  3. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  4. Ref:11430834: Ren Q, Gorovsky MA (2001) Histone H2A.Z acetylation modulates an essential charge patch. Molecular cell 7(6):1329-35
  5. Ref:11000274: Jackson JD, Gorovsky MA (2000) Histone H2A.Z has a conserved function that is distinct from that of the major H2A sequence variants. Nucleic acids research 28(19):3811-6
  6. Ref:10385122: Clarkson MJ, Wells JR, Gibson F, Saint R, Tremethick DJ (1999) Regions of variant histone His2AvD required for Drosophila development. Nature 399(6737):694-7
  7. Ref:8754831: Liu X, Li B, GorovskyMA (1996) Essential and nonessential histone H2A variants in Tetrahymena thermophila. Molecular and cellular biology 16(8):4305-11
  8. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  9. Ref:8649398: Liu X, Bowen J, Gorovsky MA (1996) Either of the major H2A genes but not an evolutionarily conserved H2A.F/Z variant of Tetrahymena thermophila can function as the sole H2A gene in the yeast Saccharomyces cerevisiae. Molecular and cellular biology 16(6):2878-87
  10. Ref:8177745: Liu X, Gorovsky MA (1993) Mapping the 5' and 3' ends of Tetrahymena thermophila mRNAs using RNA ligase mediated amplification of cDNA ends (RLM-RACE). Nucleic acids research 21(21):4954-60
  11. Ref:2587254: Mannironi C, Bonner WM, Hatch CL (1989) H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals. Nucleic acids research 17(22):9113-26
  12. Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
  13. Ref:6706903: Fusauchi Y, Iwai K (1984) Tetrahymena histone H2A. Acetylation in the N-terminal sequence and phosphorylation in the C-terminal sequence. Journal of biochemistry 95(1):147-54
  14. Ref:6885734: Fusauchi Y, Iwai K (1983) Tetrahymena histone H2A. Isolation and two variant sequences. Journal of biochemistry 93(6):1487-97

Sequences 

>TTHERM_00790790(coding)
ATGTCAACAACTGGTAAGGGAGGAAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTC
TCTAGATCCGCTAGAGCTGGTTTACAATTCCCCGTCGGTAGAATTTCCAGATTCTTGAAG
CACGGTAGATACTCTGAAAGAGTTGGTACTGGTGCTCCCGTCTACTTGGCTGCCGTCTTA
GAATACTTGGCTGCTGAAGTTCTTGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATCGTCCCCAGACACATTTTATTGGCCATCAGAAACGATGAAGAATTAAATAAA
CTCATGGCTAACACTACTATTGCTGATGGTGGTGTCTTACCCAACATTAACCCCATGCTC
TTGCCCTCTAAGTCCAAGAAGACTGAATCTAGAGGTCAAGCTTCTCAAGACCTTTGA


>TTHERM_00790790(gene)
ATGTCAACAACTGGTAAGGGAGGAAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTC
TCTAGATCCGCTAGAGCTGGTTTACAATTCCCCGTCGGTAGAATTTCCAGATTCTTGAAG
CACGGTAGATACTCTGAAAGAGTTGGTACTGGTGCTCCCGTCTACTTGGCTGCCGTCTTA
GAATACTTGGCTGCTGAAGTTCTTGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATCGTCCCCAGACACATTTTATTGGCCATCAGAAACGATGAAGAATTAAATAAA
CTCATGGCTAACACTACTATTGCTGATGGTGGTGTCTTACCCAACATTAACCCCATGCTC
TTGCCCTCTAAGTCCAAGAAGACTGAATCTAGAGGTCAAGCTTCTCAAGACCTTTGA


>TTHERM_00790790(protein)
MSTTGKGGKAKGKTASSKQVSRSARAGLQFPVGRISRFLKHGRYSERVGTGAPVYLAAVL
EYLAAEVLELAGNAAKDNKKTRIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPML
LPSKSKKTESRGQASQDL