Identifiers and Description
Gene Model Identifier
TTHERM_00283180Standard Name
HTB2 (Histone h Two B )Aliases
histone H2B-2 | PreTt04857 | 25.m00321 | 3694.m00104Description
HTB2 histone H2B.1; Histone H2B; one of the four histones (H2A- H2B- H3 and H4) that comprise the protein core of the eukaryotic nucleosome; differs from Htb1p by three amino acidsGenome Browser (Macronucleus)
Genome Browser (Micronucleus)
External Links
Gene Ontology Annotations
Cellular Component
- macronucleus (TAS) | GO:0031039
Domains
Gene Expression Profile
Vegetative Cell Cycle (Zhang et al., 2023)
GeneMania
Tetrahymena Stock Center
- ( SD02106 ) Micronucleus: neo2 KO of HTB2 Macronucleus: KO of HTB2 with neo2
Homologs
Source Identifier Score Tetrahymena borealis EI9_15821.1 2.0001503375893664e-79 Description: core histone H2A/H2B/H3/H4 family protein (122 aa) Oxytricha Contig678.1.g53 4.001202823045957e-54 Description: Core histone H2A/H2B/H3/H4 WormBase WBGene00001915 5.999460549133178e-49 Description: locus:his-41 Probable histone H2B 3 status:Confirmed UniProt:Q27484 protein_id:CAA94740.1 SGD YDR224C 3.9991604984848653e-48 Description: HTB1 Histone H2B, core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB2; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation DictyBase DDB_G0286509 6.998020510507768e-25 Description: H2Bv3 on chromosome: 4 position 4575107 to 4575571 Stentor Coeruleus SteCoe_2198 3.532628572200807e-24 Description: None
General Information
No Data fetched for General Information
Associated Literature
- Ref:19822522: Wang Z, Cui B, Gorovsky MA (2009) Histone H2B ubiquitylation is not required for histone H3 methylation at lysine 4 in tetrahymena. The Journal of biological chemistry 284(50):34870-9
- Ref:15199121: Medzihradszky KF, Zhang X, Chalkley RJ, Guan S, McFarland MA, Chalmers MJ, Marshall AG, Diaz RL, Allis CD, Burlingame AL (2004) Characterization of Tetrahymena histone H2B variants and posttranslational populations by electron capture dissociation (ECD) Fourier transform ion cyclotron mass spectrometry (FT-ICR MS). Molecular & cellular proteomics : MCP 3(9):872-86
- Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
- Ref:2713375: Nickel BE, Allis CD, Davie JR (1989) Ubiquitinated histone H2B is preferentially located in transcriptionally active chromatin. Biochemistry 28(3):958-63
- Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
- Ref:3039463: Nomoto M, Imai N, Saiga H, Matsui T, Mita T (1987) Characterization of two types of histone H2B genes from macronuclei of Tetrahymena thermophila. Nucleic acids research 15(14):5681-97
- Ref:6818230: Nomoto M, Kyogoku Y, Iwai K (1982) N-Trimethylalanine, a novel blocked N-terminal residue of Tetrahymena histone H2B. Journal of biochemistry 92(5):1675-8
- Ref:6804458: Nomoto M, Hayashi H, Iwai K (1982) Tetrahymena histone H2B. Complete amino acid sequence. Journal of biochemistry 91(3):897-904
Sequences
>TTHERM_00283180(coding)
ATGGCTCCCAAGAAAGCTCCCGCTGCTACTACTGAAAAGAAGGTCAAGAAGGCCCCCACC
ACCGAAAAGAAGAACAAGAAGAAGAGATCAGAAACCTTCGCTATTTATATCTTCAAGGTC
TTAAAGCAAGTCCACCCTGATGTCGGTATTTCCAAGAAGGCTATGAACATTATGAACTCT
TTCATTAACGACTCCTTCGAAAGAATCGCCCTCGAATCTTCCAAGTTAGTCAGATTCAAT
AAGAGAAGAACCCTCTCATCCAGGGAAGTCTAAACTGCCGTCAAGCTCTTATTACCTGGT
GAACTCGCTAGACACGCTATCTCCGAAGGTACCAAGGCCGTCACCAAGTTCTCTTCTTCC
TCCAATTGA>TTHERM_00283180(gene)
ATGGCTCCCAAGAAAGCTCCCGCTGCTACTACTGAAAAGAAGGTCAAGAAGGCCCCCACC
ACCGAAAAGAAGAACAAGAAGAAGAGATCAGAAACCTTCGCTATTTATATCTTCAAGGTC
TTAAAGCAAGTCCACCCTGATGTCGGTATTTCCAAGAAGGCTATGAACATTATGAACTCT
TTCATTAACGACTCCTTCGAAAGAATCGCCCTCGAATCTTCCAAGTTAGTCAGATTCAAT
AAGAGAAGAACCCTCTCATCCAGGGAAGTCTAAACTGCCGTCAAGCTCTTATTACCTGGT
GAACTCGCTAGACACGCTATCTCCGAAGGTACCAAGGCCGTCACCAAGTTCTCTTCTTCC
TCCAATTGA>TTHERM_00283180(protein)
MAPKKAPAATTEKKVKKAPTTEKKNKKKRSETFAIYIFKVLKQVHPDVGISKKAMNIMNS
FINDSFERIALESSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS
SN