Identifiers and Description

Gene Model Identifier

TTHERM_00001420

Standard Name

SRVW1 (Starvation-Response Von Willebrand factor 1)

Aliases

PreTt11549 | 1.m00597

Description

SRVW1 von willebrand factor type A (vWA) domain was originally protein; Von Willebrand factor type A domain containing protein; associated with cell growth inhibition

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

  • positive regulation of fast-twitch skeletal muscle fiber contraction (IDA) | GO:0031448
  • renal sodium ion transport (IDA) | GO:0003096

Domains

  • ( PF00092 ) von Willebrand factor type A

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19256.1 9.997093137033517e-262
Description: von Willebrand factor type A domain-containing protein (598 aa)
Stentor Coeruleus SteCoe_25658 2.8625185805493937e-20
Description: None
Oxytricha Contig9219.0.g29 0.000030009396760408108
Description: von Willebrand factor type A domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00001420(coding)
ATGGATAAAGATAATATTAACATTATTAACTCAATAACTAAACCATAGAAGAAGTTATCA
GTTTCAAATAAAACAGAAGCCAAAAAGATTTCTCAACCCTCTACTTTGGCTAAAAAAACT
ACATCAAACACTTCTAAAAATCTTTCTAACTAAGTCAAGACTTCTCCAGAAGTTCAATAA
TTGATTTCTTAAGTAATTAAATAAGCATCTTTAAAGCCAAAGTCAGTTGCTGTTTAAAAA
TAATCTTTAGCCTAAAACCCTATTAAAGCGAAAGCTACATAGCTTAAATCTGCAGTTTCA
AAATAACTTACTTCATTTTAAAAATCTGATATCTCTATTCAAAAGGAAGAAAAAATATAA
AAGCTAGATACCAAAACTATGCTTCGAGAGTAAGAAATTAAACCTGACTTATAACAAATG
ATTAAAGATGCTAAAAAACCATCTTATGATTTGGAAAAAGGTTTAACATTTGAAATCAAA
ACTCTTAACAAGCATTTCTAATTCAATAATGAATAAGATTGCAATATTCCTATCATGGTC
TCAGTTAAGACTTAAGATTCTACTAACGATATTTTAGAAGAGTAAAAGGAATAGGTAAAA
TAAGCAGAATAGTCAAGACCAAGCATAGATTTAGTTTGTGTTATTGATAATTCAGGATCT
ATGTAAGGAGAAAAGATTTAAAATGTTAAAACAACACTTCTTTAACTACTTGATATGTTA
AATTCTAACGATAGATTATCATTAATTCTATTCAATTCTTATCCTACTCTTTTATGTAAC
TTAAGAAAAGTTGATGATAAGAATACACCAAATATTTAGAAAATTATCAATTCTATAACT
GCTGAAGAATACACAGACATCAATAGTGGTATGCTCATGGCTTTTAATATTTTGTAAAAG
AGACAATTTTTCAACCCAGTTAGTTCTATTTTCTTGCTTTCTGATGGCCAAGATAATGGA
GCTGATGAAAAAATTAAAAAATATATCAATTCAAATCAATCATTGAAAAATGAATGCTTT
TCTATTCACTCATTTGGATTTGGTTCTGATCATGATGGCCCCTTAATGAATAGAATTTGC
TAATTAAAGGATGGTAACTTTTATTATGTTGAAAAAATTAATCAAGTTGATGAATTCTTT
GTAGATGCTCTTGGAGGACTTTTCTCTGTTGTTGCTCAAGAAATCTTAATAGAAATTAAC
CTAAACAGATAAGATAAAAATTTCTAAAAATATTTCTCAAATTGTAAAGTATCTAAAACA
TATGGAGATATGTGGAAATGTATCAAATAAGATGAGATCTATCAAATAAAAATTAATTAG
CTGTTTTCAGGAGTTTCTAAAGACTTTATTATGGAAATAGTTGTTCCGAAATAAGAAGTA
AAGATGTTAGAAGATTTTGAGAGAAATTTAGAGATAGTCAAAGGTTAGCTAACTGCTATT
CCAGTCGACATACAATACACAACAAAAATAGTGAAAGATAGCAACCTAATTTTAACTTTG
TTTTTGTAAAACGAAACTGTTCCAGTAGATTCAGAAATTAATGATGCTGTAGAATTCAAC
TATCTTAGAGTTTAAGCAGCTGAGGCTATGGAAGTAGCTATTAGTTATAGTGAAAAGTAG
TAATACGAATAAAGCTAAGTTGTATTAAAAAGTATTCTGAGCAAAATAGAGAATTCTCAT
CCCAAAAACAAATAAAAAATTTTAATTCTTAAAAAAGATCTTCTTGATTGCTAAGAGAGT
GCCTAGCCAAGAGTTTATGAGAATGTAGGTAAATATAAAATGTTAAGCAAAAAAGTAGCA
AACTCTAAGTAGGCTTCATAAGCTGTGGAAGAATGTGATATGTACTAAAACAATATTTAA
AAAGTAATGGTTATGTGTATAAAAAAAAAGAAGATGTGA


>TTHERM_00001420(gene)
ATGGATAAAGATAATATTAACATTATTAACTCAATAACTAAACCATAGAAGAAGTTATCA
GTTTCAAATAAAACAGAAGCCAAAAAGATTTCTCAACCCTCTACTTTGGCTAAAAAAACT
ACATCAAACACTTCTAAAAATCTTTCTAACTAAGTCAAGACTTCTCCAGAAGTTCAATAA
TTGATTTCTTAAGTAATTAAATAAGCATCTTTAAAGCCAAAGTCAGTTGCTGTTTAAAAA
TAATCTTTAGCCTAAAACCCTATTAAAGCGAAAGCTACATAGCTTAAATCTGCAGTTTCA
AAATAACTTACTTCATTTTAAAAATCTGATATCTCTATTCAAAAGGAAGAAAAAATATAA
AAGCTAGATACCAAAACTATGCTTCGAGAGTAAGAAATTAAACCTGACTTATAACAAATG
ATTAAAGATGCTAAAAAACCATCTTATGATTTGGAAAAAGGTTTAACATTTGAAATCAAA
ACTCTTAACAAGCATTTCTAATTCAATAATGAATAAGATTGCAATATTCCTATCATGGTC
TCAGTTAAGACTTAAGATTCTACTAACGATATTTTAGAAGAGTAAAAGGAATAGGTAAAA
TAAGCAGAATAGTCAAGACCAAGCATAGATTTAGTTTGTGTTATTGATAATTCAGGATCT
ATGTAAGGAGAAAAGATTTAAAATGTTAAAACAACACTTCTTTAACTACTTGATATGTTA
AATTCTAACGATAGATTATCATTAATTCTATTCAATTCTTATCCTACTCTTTTATGTAAC
TTAAGAAAAGTTGATGATAAGAATACACCAAATATTTAGAAAATTATCAATTCTATAACT
GCTGAAGAATACACAGACATCAATAGTGGTATGCTCATGGCTTTTAATATTTTGTAAAAG
AGACAATTTTTCAACCCAGTTAGTTCTATTTTCTTGCTTTCTGATGGCCAAGATAATGGA
GCTGATGAAAAAATTAAAAAATATATCAATTCAAATCAATCATTGAAAAATGAATGCTTT
TCTATTCACTCATTTGGATTTGGTTCTGATCATGATGGCCCCTTAATGAATAGAATTTGC
TAATTAAAGGATGGTAACTTTTATTATGTTGAAAAAATTAATCAAGTTGATGAATTCTTT
GTAGATGCTCTTGGAGGACTTTTCTCTGTTGTTGCTCAAGAAATCTTAATAGAAATTAAC
CTAAACAGATAAGATAAAAATTTCTAAAAATATTTCTCAAATTGTAAAGTATCTAAAACA
TATGGAGATATGTGGAAATGTATCAAATAAGATGAGATCTATCAAATAAAAATTAATTAG
CTGTTTTCAGGAGTTTCTAAAGACTTTATTATGGAAATAGTTGTTCCGAAATAAGAAGTA
AAGATGTTAGAAGATTTTGAGAGAAATTTAGAGATAGTCAAAGGTTAGCTAACTGCTATT
CCAGTCGACATACAATACACAACAAAAATAGTGAAAGATAGCAACCTAATTTTAACTTTG
TTTTTGTAAAACGAAACTGTTCCAGTAGATTCAGAAATTAATGATGCTGTAGAATTCAAC
TATCTTAGAGTTTAAGCAGCTGAGGCTATGGAAGTAGCTATTAGTTATAGTGAAAAGTAG
TAATACGAATAAAGCTAAGTTGTATTAAAAAGTATTCTGAGCAAAATAGAGAATTCTCAT
CCCAAAAACAAATAAAAAATTTTAATTCTTAAAAAAGATCTTCTTGATTGCTAAGAGAGT
GCCTAGCCAAGAGTTTATGAGAATGTAGGTAAATATAAAATGTTAAGCAAAAAAGTAGCA
AACTCTAAGTAGGCTTCATAAGCTGTGGAAGAATGTGATATGTACTAAAACAATATTTAA
AAAGTAATGGTTATGTGTATAAAAAAAAAGAAGATGTGA


>TTHERM_00001420(protein)
MDKDNINIINSITKPQKKLSVSNKTEAKKISQPSTLAKKTTSNTSKNLSNQVKTSPEVQQ
LISQVIKQASLKPKSVAVQKQSLAQNPIKAKATQLKSAVSKQLTSFQKSDISIQKEEKIQ
KLDTKTMLREQEIKPDLQQMIKDAKKPSYDLEKGLTFEIKTLNKHFQFNNEQDCNIPIMV
SVKTQDSTNDILEEQKEQVKQAEQSRPSIDLVCVIDNSGSMQGEKIQNVKTTLLQLLDML
NSNDRLSLILFNSYPTLLCNLRKVDDKNTPNIQKIINSITAEEYTDINSGMLMAFNILQK
RQFFNPVSSIFLLSDGQDNGADEKIKKYINSNQSLKNECFSIHSFGFGSDHDGPLMNRIC
QLKDGNFYYVEKINQVDEFFVDALGGLFSVVAQEILIEINLNRQDKNFQKYFSNCKVSKT
YGDMWKCIKQDEIYQIKINQLFSGVSKDFIMEIVVPKQEVKMLEDFERNLEIVKGQLTAI
PVDIQYTTKIVKDSNLILTLFLQNETVPVDSEINDAVEFNYLRVQAAEAMEVAISYSEKQ
QYEQSQVVLKSILSKIENSHPKNKQKILILKKDLLDCQESAQPRVYENVGKYKMLSKKVA
NSKQASQAVEECDMYQNNIQKVMVMCIKKKKM