Identifiers and Description

Gene Model Identifier

TTHERM_00006160

Standard Name

COI15 (COnjugation-Induced 15)

Aliases

PreTt11624 | 1.m00672

Description

hypothetical protein; Specifically expressed during conjugation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_40835.1 6.001376218974307e-41
Description: hypothetical protein (210 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00006160(coding)
ATGATGAAATAATTCTTGTTTGAATAGCTATCAAATAGTGTTCAAAATACCACAAATAAA
TTACTAACTCATTTAGAAGATAATTAAAAGATCATATCTCTGCTAGATAATCTCTTAAAT
TCTATGACTAATTCCTAAGTTGATTAGATGTAAATTGAATAAGTTTAAGATGATATTGAA
AAAATAAGTGATTTTGTATCTGAGATACTTGGAACTTTAGATTCTTGCCTTTTTACCTTG
GAATATAACACATAAAAGTATGTTTAGCACTTATCTAAAAAAAAGGATGATATCTAAGCG
CTATCAAATATCGATAATATTGATGTTTCGATCTCTTAAAATGGAAGAGCATAAGAGCAT
TAATTAATGAGAAATAATATATTTATGGGCAATTATAATAACATGAAATCTTAACCTGTT
TATTTATATTAAGGCTAAGAATAATATTTGCATGATGAAAATGAGGAAGACTATAGCCAA
AATGATTATTAGCAAATGAATAATGGTTTTAATGGGATAGAAGGAGATGATGAGGATGAT
ATGTATGATGAAGAAGAAAACGATTAAATTTATCTAGGAGAAGACGAATACAATGATTAA
AATTAAAATCATTAACTGAATATGATATAAAATAAACCTTAGCAATTTTAATAAATGCAA
TAGCAAAACGCTTAATAAATGTATCAAAAACAACAATAGAGTTAGCTTATTTAAAAAAAT
TCAGTATAGACTATACCAGACAAAACAAAATAAAGCAAATTCATGGAATTAGAACCTAGC
TCTAACAATTAGAAAACAACTCTGAATTCTAACTTAAACATTTAAAAACAATCTAGTAAG
ACAAAAACTGTTAGTGCTAACCTTACTGTCAACGATATATTTAACTGA


>TTHERM_00006160(gene)
ATGATGAAATAATTCTTGTTTGAATAGCTATCAAATAGTGTTCAAAATACCACAAATAAA
TTACTAACTCATTTAGAAGATAATTAAAAGATCATATCTCTGCTAGATAATCTCTTAAAT
TCTATGACTAATTCCTAAGTTGATTAGATGTAAATTGAATAAGTTTAAGATGATATTGAA
AAAATAAGTGATTTTGTATCTGAGATACTTGGAACTTTAGATTCTTGCCTTTTTACCTTG
GAATATAACACATAAAAGTATGTTTAGCACTTATCTAAAAAAAAGGATGATATCTAAGCG
CTATCAAATATCGATAATATTGATGTTTCGATCTCTTAAAATGGAAGAGCATAAGAGCAT
TAATTAATGAGAAATAATATATTTATGGGCAATTATAATAACATGAAATCTTAACCTGTT
TATTTATATTAAGGCTAAGAATAATATTTGCATGATGAAAATGAGGAAGACTATAGCCAA
AATGATTATTAGCAAATGAATAATGGTTTTAATGGGATAGAAGGAGATGATGAGGATGAT
ATGTATGATGAAGAAGAAAACGATTAAATTTATCTAGGAGAAGACGAATACAATGATTAA
AATTAAAATCATTAACTGAATATGATATAAAATAAACCTTAGCAATTTTAATAAATGCAA
TAGCAAAACGCTTAATAAATGTATCAAAAACAACAATAGAGTTAGCTTATTTAAAAAAAT
TCAGTATAGACTATACCAGACAAAACAAAATAAAGCAAATTCATGGAATTAGAACCTAGC
TCTAACAATTAGAAAACAACTCTGAATTCTAACTTAAACATTTAAAAACAATCTAGTAAG
ACAAAAACTGTTAGTGCTAACCTTACTGTCAACGATATATTTAACTGA


>TTHERM_00006160(protein)
MMKQFLFEQLSNSVQNTTNKLLTHLEDNQKIISLLDNLLNSMTNSQVDQMQIEQVQDDIE
KISDFVSEILGTLDSCLFTLEYNTQKYVQHLSKKKDDIQALSNIDNIDVSISQNGRAQEH
QLMRNNIFMGNYNNMKSQPVYLYQGQEQYLHDENEEDYSQNDYQQMNNGFNGIEGDDEDD
MYDEEENDQIYLGEDEYNDQNQNHQLNMIQNKPQQFQQMQQQNAQQMYQKQQQSQLIQKN
SVQTIPDKTKQSKFMELEPSSNNQKTTLNSNLNIQKQSSKTKTVSANLTVNDIFN