Identifiers and Description

Gene Model Identifier

TTHERM_00008800

Standard Name

REX4 (RNA exonuclease REX4)

Aliases

PreTt11690 | 1.m00738

Description

REX4 RNA exonuclease 1 DEDDh 3-prime-5-prime exonuclease domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02853.1 6.001622120184464e-159
Description: exonuclease (374 aa)
SGD YOL080C 3.998097515166115e-39
Description: REX4 Putative RNA exonuclease possibly involved in pre-rRNA processing and ribosome assembly
Oxytricha Contig15694.0.g12 1.0000633497921574e-36
Description: Exonuclease
WormBase WBGene00012465 2.998800627344286e-26
Description: status:Confirmed UniProt:Q9XXI3 protein_id:CAA19458.1
DictyBase DDB_G0291590 2.000769134519826e-18
Description: rexo1 on chromosome: 6 position 580025 to 582109
Stentor Coeruleus SteCoe_19045 0.000000000000001713908431542013
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00008800(coding)
ATGGTTGACTAAGTAGAAGATTTAGAATTAATCAAAAAGGAGAAAGATTCTTAATTAAAG
ATACTTGAATCCCTTGATTTTAGTTGTTACAACTCTAATAAAGATGATTTAGAAGAGCAA
TTTGGTGGATAGGTGAAAAAAAAGTTCAAAAATTAATTTGGAGATGCCAAAAATGTTCAT
TAGAAAGATAGAAAATTTAATAAAGTTTAGAAAACTGAATAGAAAAATGAATAATAAACA
GATGAATAATAGAAAGATAATCAGGAAAATGGGGAAGAAGTAAAATAATAGAAATAAATT
AGAAATGTAAAATAAAAAGCTCCATAGGAAGTTTCTAGTAATTGGAAAAAGTTTATGAGT
AGTCAACCTACTCAAAGCAATGACAATGAAGACAATAGCTCTAAAAAATAAATAACCAAT
AAAAAAAGTTAGTCAAGTGAAAGCTCGGGTAATTAATAAAATGTATTTAAGTCCTTAGAA
CCTTAAAAAGATGGATATAAAGGAGTAACTCCCATAGTTGCAATAGATTGTGAAATGGTT
CAGTGCGAAGCTAGCCAAAAAGACGGCTTTCCTACTTAAGAACTGGCTAGAGTATCTATA
GTAAATTATAATGGACATGTTCTTTTAGATACCTATGTAAGACCTCAAAAGAAAATTAAA
AATTATTTGACTAAAGTTAGTGGTATCACATTTACTCACATAAAAAATGCTCCTACTTAT
CCAGAGGTTAAAAACAAAATATTTGAGATACTTAAAGACAAAATTATAGTAGGTCATTCA
GTATAGCATGATTTGAGTTCCATCAAATTTGAGCCTCCCAAAGATAAAATGATCAGAGAT
ATCTCAAATTATAAAGAACTTAAGTAATCAGGAAAAAAGGTTTCTCTTAAAAAGATGGTT
AAATAAGAATTAGGAATTACCTTCCAAGAAGGCTCTCACGACTCTATTTCTGATGCAAGA
GCAGCTTTGTTGATATATAAAAAATATTAAAAGCAAATAGACTAAGAACAAGGCAAGAAA
TGA


>TTHERM_00008800(gene)
ATGGTTGACTAAGTAGAAGATTTAGAATTAATCAAAAAGGAGAAAGATTCTTAATTAAAG
ATACTTGAATCCCTTGATTTTAGTTGTTACAACTCTAATAAAGATGATTTAGAAGAGCAA
TTTGGTGGATAGGTGAAAAAAAAGTTCAAAAATTAATTTGGAGATGCCAAAAATGTTCAT
TAGAAAGATAGAAAATTTAATAAAGTTTAGAAAACTGAATAGAAAAATGAATAATAAACA
GATGAATAATAGAAAGATAATCAGGAAAATGGGGAAGAAGTAAAATAATAGAAATAAATT
AGAAATGTAAAATAAAAAGCTCCATAGGAAGTTTCTAGTAATTGGAAAAAGTTTATGAGT
AGTCAACCTACTCAAAGCAATGACAATGAAGACAATAGCTCTAAAAAATAAATAACCAAT
AAAAAAAGTTAGTCAAGTGAAAGCTCGGGTAATTAATAAAATGTATTTAAGTCCTTAGAA
CCTTAAAAAGATGGATATAAAGGAGTAACTCCCATAGTTGCAATAGATTGTGAAATGGTT
CAGTGCGAAGCTAGCCAAAAAGACGGCTTTCCTACTTAAGAACTGGCTAGAGTATCTATA
GTAAATTATAATGGACATGTTCTTTTAGATACCTATGTAAGACCTCAAAAGAAAATTAAA
AATTATTTGACTAAAGTTAGTGGTATCACATTTACTCACATAAAAAATGCTCCTACTTAT
CCAGAGGTTAAAAACAAAATATTTGAGATACTTAAAGACAAAATTATAGTAGGTCATTCA
GTATAGCATGATTTGAGTTCCATCAAATTTGAGCCTCCCAAAGATAAAATGATCAGAGAT
ATCTCAAATTATAAAGAACTTAAGTAATCAGGAAAAAAGGTTTCTCTTAAAAAGATGGTT
AAATAAGAATTAGGAATTACCTTCCAAGAAGGCTCTCACGACTCTATTTCTGATGCAAGA
GCAGCTTTGTTGATATATAAAAAATATTAAAAGCAAATAGACTAAGAACAAGGCAAGAAA
TGA


>TTHERM_00008800(protein)
MVDQVEDLELIKKEKDSQLKILESLDFSCYNSNKDDLEEQFGGQVKKKFKNQFGDAKNVH
QKDRKFNKVQKTEQKNEQQTDEQQKDNQENGEEVKQQKQIRNVKQKAPQEVSSNWKKFMS
SQPTQSNDNEDNSSKKQITNKKSQSSESSGNQQNVFKSLEPQKDGYKGVTPIVAIDCEMV
QCEASQKDGFPTQELARVSIVNYNGHVLLDTYVRPQKKIKNYLTKVSGITFTHIKNAPTY
PEVKNKIFEILKDKIIVGHSVQHDLSSIKFEPPKDKMIRDISNYKELKQSGKKVSLKKMV
KQELGITFQEGSHDSISDARAALLIYKKYQKQIDQEQGKK