Identifiers and Description

Gene Model Identifier

TTHERM_00011450

Standard Name

PUS1 (PseudoUridine Synthase 1)

Aliases

PreTt11751 | 1.m00799

Description

PUS1 tRNA pseudouridine synthase A; tRNA pseudouridine synthase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02803.1 9.997093137033517e-262
Description: tRNA pseudouridine synthase (471 aa)
WormBase WBGene00004248 1.0002124404074584e-26
Description: locus:pus-1 tRNA pseudouridine synthase status:Confirmed UniProt:Q9XXN0 protein_id:CAA16518.1
Oxytricha Contig20508.0.g59 2.99851380290819e-19
Description: tRNA pseudouridine synthase
DictyBase DDB_G0290987 2.999758165421992e-18
Description: pus1 on chromosome: 5 position 4857087 to 4859177
Stentor Coeruleus SteCoe_25308 8.533047625744066e-17
Description: None
SGD YPL212C 0.000000000000020000882446601127
Description: PUS1 tRNA:pseudouridine synthase, introduces pseudouridines at positions 26-28, 34-36, 65, and 67 of tRNA; nuclear protein that appears to be involved in tRNA export; also acts on U2 snRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011450(coding)
ATGATTTAAACTAAAAGAAATTTCTTTAAGATCAAAGTAGCAATATTCTTTGGCTATAAT
GGCAAAGGGTACCATGGTTCATAGAGCTAAAAGGACTAAAACATTAAGACTATAGAAAAG
TCATTGTTTGAAGGTTTGATAGACTCTAAATTGATTAGTGAAACACATATGGGAGAGTTA
AAAAAAGCAGGTTGGGGAAGAGGAGCTAGAACTGATAAGGGAGTTCATGCATTATGTAAT
GGCGTTAACGTTAAGTTGGCTATTAGTGAAGAGTACCTTATGAGAGGTAGTCCTCTTAGA
ATGGATGATAAAAATCCTGAAGAAATTTAAAAGGAAATATAAGAAAAAAACGAAATATTA
TTAGAATCTGAACAATATAAAAAACCAGAAGAAAACTCTGGTGAATAATAAAATGCAAAT
GGTAATTAAGCATCTGAAAAAGAAATAAAATCCTAGGCTATAGAAGAAGAAGCTGCTGAT
AATGATTAAGAAATAGCAGAAGAATAGGAAGAATAAAAGGAAGGAGAAAAAAATTTAGAA
GAAAGTAAGAAGGTTGAAGATATGACTGAAGAAGAGAGATAAGAAAGAAGTAGAAGATTA
CAATAAGAGGCTGAAGAAAACAGAAAAAAGAAGGAAGTTAGTAAGGCTCATCACAAATAA
CTGTAAGAATTTGCTAACGAAAGAAGAAAGCATATCGATATAGATAAGATTATAAATGCA
TTAAACAGCAATTTACCAGCAGATATTCGCTGTGTTTCAATTAAACAGGTATCTCGTAAA
TTTGATATTCGTACTCACTGCAAATACAGAGTATACGAATACTTAATGCCTCTTTTTATG
TATCAGAAGTATGATGACATTATAGCAGGTACTCCTATGACAGAAGAATTTGAGTAAAAA
ACCATGTAAAGAGTTTCTACATTAGCTGATAAGTTCAAAGGAACTCATAATTACCACAAT
TACACAAGATAAATGAAAGCAAAAGACCCTCGTTGTATGCGTTATATTTTAGACATGAAA
ACTGAATTAATCACCAACCCTTAAAACGGAATGAAATTCATTAGATTTACTTTAGTAGGA
TAGAGTTTTGTTTATCATTAAATTCGTAAGATGATGGGTATGATTTGCATGATGATTTAG
GAAGACTACCCTGACAACTTTATGGATTCTAGCTTTTTCCATAATGTCATGCGTATTTGG
CTTGCTCCTGCCCATGGTTTATTCCTAAATCGTATGAGATTTGATAGTTACAACAAGAAA
CCTGAAATCCCAGAACCTATTGAATTCGATAAGATTGAAGAAGATCGTTTAAGAGAAATG
AGAGATATTATTGAAAAAGCAGTCATGAACGAAGAGGATGTTAATGCAATTTACAAATAA
TGGATTAAAGATGTCAAAGCAGGAAACGAGCTTGCTGAAGAAAATGAATCTGTTTCAGGA
GATATGGATCAATGA


>TTHERM_00011450(gene)
ATGATTTAAACTAAAAGAAATTTCTTTAAGATCAAAGTAGCAATATTCTTTGGCTATAAT
GGCAAAGGGTACCATGGTTCATAGAGCTAAAAGGACTAAAACATTAAGACTATAGAAAAG
TCATTGTTTGAAGGTTTGATAGACTCTAAATTGATTAGTGAAACACATATGGGAGAGTTA
AAAAAAGCAGGTTGGGGAAGAGGAGCTAGAACTGATAAGGGAGTTCATGCATTATGTAAT
GGCGTTAACGTTAAGTTGGCTATTAGTGAAGAGTACCTTATGAGAGGTAGTCCTCTTAGA
ATGGATGATAAAAATCCTGAAGAAATTTAAAAGGAAATATAAGAAAAAAACGAAATATTA
TTAGAATCTGAACAATATAAAAAACCAGAAGAAAACTCTGGTGAATAATAAAATGCAAAT
GGTAATTAAGCATCTGAAAAAGAAATAAAATCCTAGGCTATAGAAGAAGAAGCTGCTGAT
AATGATTAAGAAATAGCAGAAGAATAGGAAGAATAAAAGGAAGGAGAAAAAAATTTAGAA
GAAAGTAAGAAGGTTGAAGATATGACTGAAGAAGAGAGATAAGAAAGAAGTAGAAGATTA
CAATAAGAGGCTGAAGAAAACAGAAAAAAGAAGGAAGTTAGTAAGGCTCATCACAAATAA
CTGTAAGAATTTGCTAACGAAAGAAGAAAGCATATCGATATAGATAAGATTATAAATGCA
TTAAACAGCAATTTACCAGCAGATATTCGCTGTGTTTCAATTAAACAGGTATCTCGTAAA
TTTGATATTCGTACTCACTGCAAATACAGAGTATACGAATACTTAATGCCTCTTTTTATG
TATCAGAAGTATGATGACATTATAGCAGGTACTCCTATGACAGAAGAATTTGAGTAAAAA
ACCATGTAAAGAGTTTCTACATTAGCTGATAAGTTCAAAGGAACTCATAATTACCACAAT
TACACAAGATAAATGAAAGCAAAAGACCCTCGTTGTATGCGTTATATTTTAGACATGAAA
ACTGAATTAATCACCAACCCTTAAAACGGAATGAAATTCATTAGATTTACTTTAGTAGGA
TAGAGTTTTGTTTATCATTAAATTCGTAAGATGATGGGTATGATTTGCATGATGATTTAG
GAAGACTACCCTGACAACTTTATGGATTCTAGCTTTTTCCATAATGTCATGCGTATTTGG
CTTGCTCCTGCCCATGGTTTATTCCTAAATCGTATGAGATTTGATAGTTACAACAAGAAA
CCTGAAATCCCAGAACCTATTGAATTCGATAAGATTGAAGAAGATCGTTTAAGAGAAATG
AGAGATATTATTGAAAAAGCAGTCATGAACGAAGAGGATGTTAATGCAATTTACAAATAA
TGGATTAAAGATGTCAAAGCAGGAAACGAGCTTGCTGAAGAAAATGAATCTGTTTCAGGA
GATATGGATCAATGA


>TTHERM_00011450(protein)
MIQTKRNFFKIKVAIFFGYNGKGYHGSQSQKDQNIKTIEKSLFEGLIDSKLISETHMGEL
KKAGWGRGARTDKGVHALCNGVNVKLAISEEYLMRGSPLRMDDKNPEEIQKEIQEKNEIL
LESEQYKKPEENSGEQQNANGNQASEKEIKSQAIEEEAADNDQEIAEEQEEQKEGEKNLE
ESKKVEDMTEEERQERSRRLQQEAEENRKKKEVSKAHHKQLQEFANERRKHIDIDKIINA
LNSNLPADIRCVSIKQVSRKFDIRTHCKYRVYEYLMPLFMYQKYDDIIAGTPMTEEFEQK
TMQRVSTLADKFKGTHNYHNYTRQMKAKDPRCMRYILDMKTELITNPQNGMKFIRFTLVG
QSFVYHQIRKMMGMICMMIQEDYPDNFMDSSFFHNVMRIWLAPAHGLFLNRMRFDSYNKK
PEIPEPIEFDKIEEDRLREMRDIIEKAVMNEEDVNAIYKQWIKDVKAGNELAEENESVSG
DMDQ