Identifiers and Description

Gene Model Identifier

TTHERM_00011760

Standard Name

RPC19 (RNA polymerases I and III common subunit Rpc19 )

Aliases

PreTt11782 | 1.m00830

Description

RPC19 DNA-directed RNA polymerase I and III 14 kDa protein; RNA polymerases I and III common subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( TIGR01563 ) phage head-tail adaptor, putative

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02771.1 6.001309080488961e-82
Description: DNA-directed RNA polymerase I subunit D (150 aa)
SGD YNL113W 1.9993007828132465e-27
Description: RPC19 RNA polymerase subunit AC19, common to RNA polymerases I and III
Oxytricha Contig22515.0.g14 3.99801309251602e-27
Description: RNA polymerase Rpb3/Rpb11 dimerisation domain
DictyBase DDB_G0291362 3.999970367130025e-21
Description: rpc19 on chromosome: 6 position 182518 to 183059
WormBase WBGene00010230 7.000255027549774e-17
Description: locus:rpac-19 Probable DNA-directed RNA polymerases I and III subunit RPAC2 status:Confirmed UniProt:P34476 protein_id:CAA80165.1
Stentor Coeruleus SteCoe_21654 0.00000000027894680928689246
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011760(coding)
ATGTCAGATAGCGAAGAAAATTCATTCCAAGAAATTGAATAGGAAGATGACGAAGCTGTC
AACAATCCTGATATTGAAGAGGAAGAAGAAGATGAAGATTATATGATGGAAGATAAGCCT
AAAAAGCAATCTGCAGAAGAAAAGCTTGTTATTGACTAAAATGAAAAAGATAGAACTTGC
GCTACTTATACTTTCTATGATGAAGACCACACCCTTGGAAATACAGTTAGATATATGCTT
GTAAAGAGAAAAGATGTAGAATTCTGTGGTTATACAATTCCTCACCCTTCTGAAAATAAA
ATGAATTTACGTTTATAAACAATAAAAAAAAATTCAAATGAAGTATTAAAAGAAGGATTA
GATAGTTTGGCTGGACTTTGTGATGTACTTAATGACAAATTTGATGCTGCTATGAAAAAA
TTTGAAAAACAATAAAAAAAGAAATCAAAATGA


>TTHERM_00011760(gene)
ATGTCAGATAGCGAAGAAAATTCATTCCAAGAAATTGAATAGGAAGATGACGAAGCTGTC
AACAATCCTGATATTGAAGAGGAAGAAGAAGATGAAGATTATATGATGGAAGATAAGCCT
AAAAAGCAATCTGCAGAAGAAAAGCTTGTTATTGACTAAGTAATAAATTATCAAAGATTA
ATTGATTGATTAAATTAGGAATAGAAATGAAAACATAAAAAATTGAGTTAGTTTTTAAGA
CTAAAGCATAGAATTTACGATAATTACAAAATAAATGTTTTTAATAAGCAAGCTGAACAT
TTTTTTATAAAATTAGAATGAAAAAGATAGAACTTGCGCTACTTATACTTTCTATGATGA
AGACCACACCCTTGGAAATACAGTTAGATATATGCTTGTAAAGAGAAAAGATGTAGAATT
CTGTGGTTATACAATTCCTCACCCTTCTGAAAATAAAATGAATTTACGTTTATAAACAAT
AAGTAATTTGGTTTATTAGTTTGTGCTTAGTTTTATAAAATAATACATTTTTTTCATAAA
ATAATAGAAAAAAATTCAAATGAAGTATTAAAAGAAGGATTAGATAGTTTGGCTGGACTT
TGTGATGTACTTAATGACAAATTTGATGCTGCTATGAAAAAATTTGAAAAACAATAAAAA
AAGAAATCAAAATGA


>TTHERM_00011760(protein)
MSDSEENSFQEIEQEDDEAVNNPDIEEEEEDEDYMMEDKPKKQSAEEKLVIDQNEKDRTC
ATYTFYDEDHTLGNTVRYMLVKRKDVEFCGYTIPHPSENKMNLRLQTIKKNSNEVLKEGL
DSLAGLCDVLNDKFDAAMKKFEKQQKKKSK