Identifiers and Description

Gene Model Identifier

TTHERM_00012980

Standard Name

ATG10 (AutTophaGy 10)

Aliases

PreTt11805 | 1.m00853

Description

ATG10 autophagocytosis associated protein active-site protein; Autophagy protein; involved in programmed nuclear degradation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF03986 ) Autophagocytosis associated protein, N-terminal domain
  • ( PF03987 ) Autophagocytosis associated protein, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02752.1 2.0004683842646898e-122
Description: autophagocytosis associated protein domain-containing protein (225 aa)
Oxytricha Contig10290.0.g21 9.99648502569394e-38
Description: Autophagocytosis associated protein (Atg3), N-terminal domain
DictyBase DDB_G0277319 4.00073564232477e-35
Description: atg3 on chromosome: 2 position 7690557 to 7691968
WormBase WBGene00021922 5.001425520048966e-32
Description: locus:atg-3 Autophagy-related protein 3 status:Confirmed UniProt:Q9N369 protein_id:CCD74062.1
SGD YNR007C 9.000561397357242e-21
Description: ATG3 E2-like enzyme involved in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; plays a role in formation of Atg8p-phosphatidylethanolamine conjugates, which are involved in membrane dynamics during autophagy and Cvt
Stentor Coeruleus SteCoe_7809 4.248354255291589e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00012980(coding)
ATGAATGCATTTAGTAATTTTGTTAGCTCATTTAAGACACCATCACCTGAAGATTTTGAT
AAGCATGGTTTTTTGACTCCTAAGTAATTTTTGGAATCAGGTGATTAATTAACTTTAATG
GGATGGAAGTGGGAAAAGGTCGATGACAATAAAAAGCTCAACAAAAGTTTGACAGATCCT
AAAAAGTAGTTTTTAACCTTTTAGGGAAGAAGTTTAAACAGAATCAAAAAGAATGTTTTT
GATGATTTAGAAGAGAAAGTTAATAGTGAAGGATTTGTTGAGACTAGCCAACGTTAATCA
AATGCTTAAGATAATCAAGAAGAAGAAGAAGAAATGAGAATATATAACTTTTCTATTACT
TATGACACTTATTATCATGTTCCAAGAATTTGGTTTTCTGGAGTTGATGAAAACCAAAAA
CCTTTAAAGAAAGAATAAATGTTCGAAGATGTAATGCCAGAGTATAGAGACGAAACAGTC
ACCCTTGAAAAACACCCTCACTTAGGATATGATTAAATGACAATCCACCCTTGCAAACAC
TCATAAATCCTTAAAAGTTTTATTGATCAAGCAAAGGAAAATGGAAGAACTATTAAACCT
AATCAAGCCCTTATTATTTTCCTTAAATTCGTAGGCTCAGTTCTACCCACTTTAGAAATA
GAAACAACTACAGATTTAGAGATTTGA


>TTHERM_00012980(gene)
ATGAATGCATTTAGTAATTTTGTTAGCTCATTTAAGACACCATCACCTGAAGATTTTGAT
AAGCATGGTTTTTTGACTCCTAAGTAATTTTTGGAATCAGGTGATTAATTAACTTTAATG
GGATGGAAGTGGGAAAAGGTCGATGACAATAAAAAGCTCAACAAAAGTTTGACAGATCCT
AAAAAGTAGTTTTTAACCTTTTAGGGAAGAAGTTTAAACAGAATCAAAAAGAATGTTTTT
GATGATTTAGAAGAGAAAGTTAATAGTGAAGGATTTGTTGAGACTAGCCAAGTAATTTTC
TTAAATTTCTTTTATTTGTGTAAAACCAATTTGTTGTTGAAACAAAAAAAAAACAACTTC
AAAAAATTTTAATAGCAAGAAAGCTAAAAAAAAGCAAATAAATGTAAAATTTAAAAAAAC
CTATATCTGATTCGTTCTTTATATAAATATTTAGCGTTAATCAAATGCTTAAGATAATCA
AGAAGAAGAAGAAGAAATGAGAATATATAACTTTTCTATTACTTATGACACTTATTATCA
TGTTCCAAGAATTTGGTTTTCTGGAGTTGATGAAAACCAAAAACCTTTAAAGAAAGAATA
AATGTTCGAAGATGTAATGCCAGAGTATAGAGACGAAACAGTAATAATTTTAATTTTGCA
ATTAAATGATTGATCGATTAGATGCAAATCAATTTAATTTTATGTAATTTTAACATTAAT
TTAAATCAAAAAAGGTCACCCTTGAAAAACACCCTCACTTAGGATATGATTAAATGACAA
TCCACCCTTGCAAACACTCATAAATCCTTAAAAGTTTTATTGATCAAGCAAAGGAAAATG
GAAGAACTATTAAACCTAATCAAGCCCTTATTATTTTCCTTAAATTCGTAGGCTCAGTTC
TACCCACTTTAGAAATAGAAACAACTACAGATTTAGAGATTTGA


>TTHERM_00012980(protein)
MNAFSNFVSSFKTPSPEDFDKHGFLTPKQFLESGDQLTLMGWKWEKVDDNKKLNKSLTDP
KKQFLTFQGRSLNRIKKNVFDDLEEKVNSEGFVETSQRQSNAQDNQEEEEEMRIYNFSIT
YDTYYHVPRIWFSGVDENQKPLKKEQMFEDVMPEYRDETVTLEKHPHLGYDQMTIHPCKH
SQILKSFIDQAKENGRTIKPNQALIIFLKFVGSVLPTLEIETTTDLEI