Identifiers and Description

Gene Model Identifier

TTHERM_00013150

Standard Name

MRNC59 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt11821 | 1.m00869

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02735.1 9.997093137033517e-262
Description: hypothetical protein (1884 aa)
Oxytricha Contig7961.0.g38 2.0008536325002377e-42
Description: MORN repeat
DictyBase DDB_G0349488 1.0002869940498747e-21
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
Stentor Coeruleus SteCoe_36686 2.8625185805493937e-20
Description: None
WormBase WBGene00002179 0.0000000006000548789370351
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013150(coding)
ATGCAATTTGAATAGTTGATTGAGAATTCTACAGTTAAAGATCTGAAGATAAACTATAAA
AAGGATTATAGAGAAAACTATAAATTGGTGAGGGATGAGACGATATATGGACTGTCAGTT
TGTAAGACTTATATTTAAAAGAATATAAAGACAAATGAAATGTTTTTGTGTGTTTAAGAG
ACTTTCTATGATCATTAATCGCCAAAAATAATTAATATGCTAGAAACTTTACAGGTAATT
AATGAAAATCCTTTCTTTAATTAATTCAGGGCATTTAGCTATGAAGAACTTCAATAGAAA
TCAGTTAGAATTTATATTTTGATTGAATATTACGATATGAATTTGATTAAAATAGCTAAA
AAGAGGACTTTGATAGATAAAAATTTGATTGATAGTCTCACAAAATGTTTTCTTTGCTCG
ATATAATTCTTGTTCAAAATCGAATCTTCTCTTTTAGCCATTCACAGCTCTAATGTATTT
TTAAAGTAAATGAGTGCTAATATTAATGATGGCTACCTTGTAAAAATACTTTACTTTCCT
TTCATGTAGTCTTCTTTTGACATGGTTTTGTCAGGTAAAGAAAAACATTATAACTGCTAT
TTATCAGTAGAAGAGCTTGAATGTCTTGATAAAAAGTTAGAAAATATAGAAATCAACAAT
ACATAATCAAATATTTTTAGTTTTGGGGCACTTTTACTAGATTTGTTAAATTGTGCTAAT
CCAAATGCGAATGGAATTTCGCTCATTTACTGCAAAGACAGCTACAGGATTGATGAAACT
AACTTTTTTGAGAGAATAAACTTCGTTGCAGAGAAATATCCCAAAAGGGTGTTTCTTCTA
CTTGAGTAGCTTCTTAAATTTAATGACAGATAAACACCAAGACAAATTATGAAGCTCTAT
GAAAATTAATCTCAAATAAATAACAGCTAAATCGCTGATGACACAATAGCAAATGCTAAA
TAAAGGATCTAAATGTAACTTTACAGTGAATTCCCAATAAAAAGCAATGTTGTAAATTCT
CCATCTAATTATAACTTCGCATAAAAATAAAAACAAAATACTCTCAATAACAATAATAAT
TCTAGTGAACAGCAAACATTTTCTAATTCAGCCTTTCAAAGTAACCAAGAAGAACCTATT
TATTACAACAACAATCTGAGCAATAATCAAAATAAAATAAATAATGAATTTTAAAATAAC
GAATTTTAAGATAGAAAATATAATTAACAGATTTAATCTCCACAAGATTTTTAAAGTAAT
AAAAACAACAATTAAGTGATAAACCCTCTTGGAAGCAGTTCTCAGTTTGATTAAGACTCA
AATAGAAATTAAAAGACTAGAAGCAAATGGGATATACCTTCTATTCACAATTCTGGATCT
CGTTAGTTTAACCCAATAGTTACTCCTTTTTCTAACAATCAGCTCTCTCCAACTGAAAGG
AATGAATATGCAAACAACATTCGATATGCTGAAGATTCTCCTACTTTTGCCAATTAAAAC
AATATTTCACCTTCTTATTAACTTTCCTCAGAAAGTGGTAATAAAAACTAGTAAAATTCT
TTGTACAATCAAAACTCTAATAACAACGATTATAATTAATTTCTTTTCCAAAGTATTGAC
AAAGATGCAGAATAAAAAAATAGAAAATTTGCTGTTCAAGGTAGAGGAGAAGATAACTAA
GTAGTTTATAAAAAATAACCAGACTAAATTTCGTCTGAATATTTTAAGCCGAACAACTCT
TCATCAAATAATTAATCATAATAGTTTGATTTCAATTTTTATAACTAAATTTAAAATGAT
AATGATAAATACATGAACAAAGATCTCCCCTCAATACAGATTTAAAAAGTAGAGTCTAAT
TATGAAAACCATTCGCAGTAACCAAATAATAATAAAAATTATGATTAGCAAAACAGTAAA
TTTCTCCTTAGTCCTTCATCTCAATTTTCTAATAATGATTCGAGTTAACAATAGTATTCC
AAAGAAATACCATAGGCACCTTAATTACCTTCAGCTCCTTCAGCATAATCCTAAAAAGGA
GCTAAAGATGACTATTAAAAAAATACAATTCCATAAGCTCCTTTATTGAATGAAAATAGC
CATTTAAAAACACCTCAAGTTAATACAATACCCTAGGCACCTTCTCTTAATACAATTCCT
TTAGCACCTCCATTAAACGGAATTTAAGTACCAAAAACAAATACCATTCCTCCAGCGCCT
TAATTAGCAGGTATCCCTCCTGCTCCCTTTATTGGTGGTATACCTCCAGCCCCTCCAATA
GGTGGTATTCCTCCAGCACCTCCAATTGGAAATACCTCTCAAGGATCTCAGCTAAATGGT
ATACCTCCTGCACCTTAAATAAATGGGATTCCTAAAGCTCCTCCATTATTAAATGGAATC
CCTTCAGCACCTCCTATGAGCATTTTATAAGAAAAAAATAAAAATAATTAATAACCAATA
CAACATTTACAGAGTATGATATAAAATTCTTTAGAAGTTACAGATGAAAATAATGAATAA
GAGTAAATTAGGAAAAAAGAAGAAGTTCTTTAAAGGTTATTTTAAAATAATAATTAAGCA
GCACCTGTTAGACTTCCATTCTTTCTTCCAAATCAAGGAGTTAAAAAGGAAATTAAAGAC
GAAAATAATGCAAAGCAGGCAGACTAAAAAGAAGAAATAAAAAATGATAAAAATAAAGAA
TTAATTGGTATCCCTCCTGCACCATAAAACTTGATTCCTCCTCCCCCACCACTTCCTCTT
TCTAATATTTTAGTAGACACTAACTATGTTGTTAAGCCGAAATTAGAGGCTGATACAACT
GTAAGAGATGAGTAAAAGGAAAGAATAGAAAATCACAAAAAGACATAAAATCAGTTAAAA
AAAGAGTCAAACGATGCTTTACTTCAATCTTAATCAGTTCTAGAAAGCTCTTAAAGATTA
ATAGATAAAGCAAGTAAAGTAAAACTTCCAGAAAATTAAACATATTCGACGACGATACTT
GAAGAAGATGAAAACTCTGCTAACAAGAAGGACACTTTGGACACTTATAGAACTTTAAAA
GCAAGAGAAAATGAATATTTGAATTTAAAATAATAAAACTTAATGAAATCTCAGCAATAA
ATAAATCTTTCTAAAGAAGAAGAGCTCAAAAAAATAAGAAATAATCACTCACAACTGCTT
GATAATTAAAATTAACATTAGTAACGAAGCATTGAAAATTCAGTTTTGAATGCTAGTAAT
AAAGGAGATTTTTATAACAATAGAAAATACTAAGATGGAAACAATCAAATTTAAAACCAA
AATGAAAGCTAGCAGCAATCAAATTTATATGCCTCATTCAATCCTGACAGCCAAGAAAAA
TCTCATGACATCCATAGCTTTAATGAAAATTCTGTTGCAGTTTTTGATAATGAAGGAAGT
CTCCAGAATCAGCACAAACTAAATTTTGAAAGTATTTAAAATGAAAGAGAAATAAACCAT
GGTGGTAAAGATTACAATAGGTAAAACGACAGAAGTGATTTAAATGATAATTAACAATTT
TTATCTCCTTAGAAAAAATAAAATAAAGTTTCTTCTGACTATGATTTAGAAAGTTATAGA
AACGAGGACAATTAATCATCTTGGAGATTTAGACAAACTCCACCTTAGTTTTAAGATGGC
TATGGGTTTGAAAATGGCATAACTCAATATCAGATGAACAATTCTTAAATTTCTAACTAA
GATAATAATTTTAGGAGTTCCTAAATTGATTAAAGCGCCTACAAATTTCCCACTAATGTT
ATTCAGGTGATTAATTCTATTGGAGGATCACTGAATTAATCTAGTGATTAGTCTTCGAGT
ATAGTCTAAGAAGCTATTCGATATAATTAGCAACAAGAAATAATACAGTAGCTTTATCCC
AACTTAAATAACTCAGAAAGTAGATTTTAAAATCGCTCAGAATATCTTTAGGAATCTAAC
TTTTAACCAAATGTCTATAATAACTAATATGATGGAATTTAAAGCAGCTATTAACCTTAA
AAAAATTAATTTCAGTAAAAGAACGCATAAAATTAAAATAATTCTCCTGAATCTACTGAA
AATACCTACAACAGCTATCCTTATTAAAAAAATAATTAAAATTAACCATAGAATTACCAA
CTAAACAGCCCTACCACCTAGCTTAACAGCAGTTAGAATAATTTAAACAGCAGTTCATAC
ACTCCAAGTTCTAACTTTTAAAAAAATAGCTTATACAAAAATAATGATTTTATTGAAGAA
TAAAGCTAAGAGTCAGAACCTGAAGAATAAAACTCTCTAATCTACAAATCACCAATCTAA
AAGAATGTAAAAGACTATATGAGCTAACTACAAAAAAATAAAGAATTCTTTGAGCAACTT
CGTAAGCAGAGACCTCAAGGCTCTAAGTAATTTGATCCTTAAGAGTTTGAATAAATAGTT
CAATAAGCCAACTAAGAACCTGATAAAAAAGGAGTGAGAAACAGCTACAAAAATTCATCT
TAAGATTCTGGAATTCAAAGCTATTTACCTCAAGTAGATTAAGTAGTTGAAAATAATTTC
GAGTATCCTTAAAACCAAAGCAATCAAAACAGCACATTAGATTCCTACATTGAAAAAACA
ATAGATGAGTAGATTTATGAAGACAATAAAAATCTCTTTTTTTCAGAATTTTAAGATTTT
TAAGATAAGGAAGCTTTAATTGCTGAATTGTATTAGCAACTTCAAAAATTCCCAGATACT
AAAAAAATATAATATAAAAACAAATCTTTTTATGAAGGATAAGTTCAAGTTACAGACAGG
AGCATTGTTAGAAACGGATTTGGAATCCTAAAAATGTAAAATGGGGACATTTATTGTGGT
TATTTTAAGAACAACTAATTCGATGGAGAGGGTGTTTATTTTTACAATCATGGAGATATT
TACAGAGGCTAACTTCGCAAAGATCTCAGATAAGGACACGGAACTTACTATTACCATGGA
TTAGGATTCATTTATTCTGGGGAATGGAATGGAAACGTGAAAGAAGGCTACGGAAGACTT
CTAATGAAAAACAAAGAGAAATATGAAGGCTATTTTAAATAGAATGTAAAATGTGGTAGA
GGTATTTACTATTTTGCTAACGGGGATACATTTGATGGTGAATGGGTCTATGATAAGAAA
TGTGGATTTGGTACCTTAGAGTTCAAGGATGGTAACCACTTCGAAGGTAATTTTTATGAT
GATCTTCCTTATGGCTAGGGTTAAATGAAGTTTAAAAATGGGGATGAATATAGTGGAAAC
TATGAAGATGGATTAATTTCTGGTTATGGTATTTACATACATGCCAATTAACAATACTAT
GAAGGAGATTTTAGTAAAAACTAAATGAATGGAGAAGGAATATATTATTTTAAAAATGGG
GATAAGTATTAGGGATAATATATAGATGGAATTCGAGAAGGTTATGGAAAGTATTTCTAT
TAAAATGGTTGTATCTACGAAGGTTAATGGGTAAACAATTAAAAGCATGGTGAAGGAAGG
TATATTTTCCCTGATAATACATATTACTAAGGTTCATTTGAAAATTCAATGAAGTCCGGA
ATAGGAAAATAAACATTTAAAGAAAATGAATTCTATAATGGGTAATGGAGAAATGATAAG
AGAAATGGGAAGGGATTTTATTAATTTAAAGATGGAAGCTACTATGAAGGAGATTGGCTA
AATGACAAAATGCACGGCGAAGGAACTTATAATCTCAAAACTAGTTCTGGCTTTAGAAAG
ATTTATGGAATTTGGAGCGATGATGAACTTTATTAAAGTTTTGAATGA


>TTHERM_00013150(gene)
ATGCAATTTGAATAGTTGATTGAGAATTCTACAGTTAAAGATCTGAAGATAAACTATAAA
AAGGATTATAGAGAAAACTATAAATTGGTGAGGGATGAGACGATATATGGACTGTCAGTT
TGTAAGACTTATATTTAAAAGAATATAAAGACAAATGAAATGTTTTTGTGTGTTTAAGAG
ACTTTCTATGATCATTAATCGCCAAAAATAATTAATATGCTAGAAACTTTACAGGTAATT
AATGAAAATCCTTTCTTTAATTAATTCAGGGCATTTAGCTATGAAGAACTTCAATAGAAA
TCAGTTAGAATTTATATTTTGATTGAATATTACGATATGAATTTGATTAAAATAGCTAAA
AAGAGGACTTTGATAGATAAAAATTTGATTGATAGTCTCACAAAATGTTTTCTTTGCTCG
ATATAATTCTTGTTCAAAATCGAATCTTCTCTTTTAGCCATTCACAGCTCTAATGTATTT
TTAAAGTAAATGAGTGCTAATATTAATGATGGCTACCTTGTAAAAATACTTTACTTTCCT
TTCATGTAGTCTTCTTTTGACATGGTTTTGTCAGGTAAAGAAAAACATTATAACTGCTAT
TTATCAGTAGAAGAGCTTGAATGTCTTGATAAAAAGTTAGAAAATATAGAAATCAACAAT
ACATAATCAAATATTTTTAGTTTTGGGGCACTTTTACTAGATTTGTTAAATTGTGCTAAT
CCAAATGCGAATGGAATTTCGCTCATTTACTGCAAAGACAGCTACAGGATTGATGAAACT
AACTTTTTTGAGAGAATAAACTTCGTTGCAGAGAAATATCCCAAAAGGGTGTTTCTTCTA
CTTGAGTAGCTTCTTAAATTTAATGACAGATAAACACCAAGACAAATTATGAAGCTCTAT
GAAAATTAATCTCAAATAAATAACAGCTAAATCGCTGATGACACAATAGCAAATGCTAAA
TAAAGGATCTAAATGTAACTTTACAGTGAATTCCCAATAAAAAGCAATGTTGTAAATTCT
CCATCTAATTATAACTTCGCATAAAAATAAAAACAAAATACTCTCAATAACAATAATAAT
TCTAGTGAACAGCAAACATTTTCTAATTCAGCCTTTCAAAGTAACCAAGAAGAACCTATT
TATTACAACAACAATCTGAGCAATAATCAAAATAAAATAAATAATGAATTTTAAAATAAC
GAATTTTAAGATAGAAAATATAATTAACAGATTTAATCTCCACAAGATTTTTAAAGTAAT
AAAAACAACAATTAAGTGATAAACCCTCTTGGAAGCAGTTCTCAGTTTGATTAAGACTCA
AATAGAAATTAAAAGACTAGAAGCAAATGGGATATACCTTCTATTCACAATTCTGGATCT
CGTTAGTTTAACCCAATAGTTACTCCTTTTTCTAACAATCAGCTCTCTCCAACTGAAAGG
AATGAATATGCAAACAACATTCGATATGCTGAAGATTCTCCTACTTTTGCCAATTAAAAC
AATATTTCACCTTCTTATTAACTTTCCTCAGAAAGTGGTAATAAAAACTAGTAAAATTCT
TTGTACAATCAAAACTCTAATAACAACGATTATAATTAATTTCTTTTCCAAAGTATTGAC
AAAGATGCAGAATAAAAAAATAGAAAATTTGCTGTTCAAGGTAGAGGAGAAGATAACTAA
GTAGTTTATAAAAAATAACCAGACTAAATTTCGTCTGAATATTTTAAGCCGAACAACTCT
TCATCAAATAATTAATCATAATAGTTTGATTTCAATTTTTATAACTAAATTTAAAATGAT
AATGATAAATACATGAACAAAGATCTCCCCTCAATACAGATTTAAAAAGTAGAGTCTAAT
TATGAAAACCATTCGCAGTAACCAAATAATAATAAAAATTATGATTAGCAAAACAGTAAA
TTTCTCCTTAGTCCTTCATCTCAATTTTCTAATAATGATTCGAGTTAACAATAGTATTCC
AAAGAAATACCATAGGCACCTTAATTACCTTCAGCTCCTTCAGCATAATCCTAAAAAGGA
GCTAAAGATGACTATTAAAAAAATACAATTCCATAAGCTCCTTTATTGAATGAAAATAGC
CATTTAAAAACACCTCAAGTTAATACAATACCCTAGGCACCTTCTCTTAATACAATTCCT
TTAGCACCTCCATTAAACGGAATTTAAGTACCAAAAACAAATACCATTCCTCCAGCGCCT
TAATTAGCAGGTATCCCTCCTGCTCCCTTTATTGGTGGTATACCTCCAGCCCCTCCAATA
GGTGGTATTCCTCCAGCACCTCCAATTGGAAATACCTCTCAAGGATCTCAGCTAAATGGT
ATACCTCCTGCACCTTAAATAAATGGGATTCCTAAAGCTCCTCCATTATTAAATGGAATC
CCTTCAGCACCTCCTATGAGCATTTTATAAGAAAAAAATAAAAATAATTAATAACCAATA
CAACATTTACAGAGTATGATATAAAATTCTTTAGAAGTTACAGATGAAAATAATGAATAA
GAGTAAATTAGGAAAAAAGAAGAAGTTCTTTAAAGGTTATTTTAAAATAATAATTAAGCA
GCACCTGTTAGACTTCCATTCTTTCTTCCAAATCAAGGAGTTAAAAAGGAAATTAAAGAC
GAAAATAATGCAAAGCAGGCAGACTAAAAAGAAGAAATAAAAAATGATAAAAATAAAGAA
TTAATTGGTATCCCTCCTGCACCATAAAACTTGATTCCTCCTCCCCCACCACTTCCTCTT
TCTAATATTTTAGTAGACACTAACTATGTTGTTAAGCCGAAATTAGAGGCTGATACAACT
GTAAGAGATGAGTAAAAGGAAAGAATAGAAAATCACAAAAAGACATAAAATCAGTTAAAA
AAAGAGTCAAACGATGCTTTACTTCAATCTTAATCAGTTCTAGAAAGCTCTTAAAGATTA
ATAGATAAAGCAAGTAAAGTAAAACTTCCAGAAAATTAAACATATTCGACGACGATACTT
GAAGAAGATGAAAACTCTGCTAACAAGAAGGACACTTTGGACACTTATAGAACTTTAAAA
GCAAGAGAAAATGAATATTTGAATTTAAAATAATAAAACTTAATGAAATCTCAGCAATAA
ATAAATCTTTCTAAAGAAGAAGAGCTCAAAAAAATAAGAAATAATCACTCACAACTGCTT
GATAATTAAAATTAACATTAGTAACGAAGCATTGAAAATTCAGTTTTGAATGCTAGTAAT
AAAGGAGATTTTTATAACAATAGAAAATACTAAGATGGAAACAATCAAATTTAAAACCAA
AATGAAAGCTAGCAGCAATCAAATTTATATGCCTCATTCAATCCTGACAGCCAAGAAAAA
TCTCATGACATCCATAGCTTTAATGAAAATTCTGTTGCAGTTTTTGATAATGAAGGAAGT
CTCCAGAATCAGCACAAACTAAATTTTGAAAGTATTTAAAATGAAAGAGAAATAAACCAT
GGTGGTAAAGATTACAATAGGTAAAACGACAGAAGTGATTTAAATGATAATTAACAATTT
TTATCTCCTTAGAAAAAATAAAATAAAGTTTCTTCTGACTATGATTTAGAAAGTTATAGA
AACGAGGACAATTAATCATCTTGGAGATTTAGACAAACTCCACCTTAGTTTTAAGATGGC
TATGGGTTTGAAAATGGCATAACTCAATATCAGATGAACAATTCTTAAATTTCTAACTAA
GATAATAATTTTAGGAGTTCCTAAATTGATTAAAGCGCCTACAAATTTCCCACTAATGTT
ATTCAGGTGATTAATTCTATTGGAGGATCACTGAATTAATCTAGTGATTAGTCTTCGAGT
ATAGTCTAAGAAGCTATTCGATATAATTAGCAACAAGAAATAATACAGTAGCTTTATCCC
AACTTAAATAACTCAGAAAGTAGATTTTAAAATCGCTCAGAATATCTTTAGGAATCTAAC
TTTTAACCAAATGTCTATAATAACTAATATGATGGAATTTAAAGCAGCTATTAACCTTAA
AAAAATTAATTTCAGTAAAAGAACGCATAAAATTAAAATAATTCTCCTGAATCTACTGAA
AATACCTACAACAGCTATCCTTATTAAAAAAATAATTAAAATTAACCATAGAATTACCAA
CTAAACAGCCCTACCACCTAGCTTAACAGCAGTTAGAATAATTTAAACAGCAGTTCATAC
ACTCCAAGTTCTAACTTTTAAAAAAATAGCTTATACAAAAATAATGATTTTATTGAAGAA
TAAAGCTAAGAGTCAGAACCTGAAGAATAAAACTCTCTAATCTACAAATCACCAATCTAA
AAGAATGTAAAAGACTATATGAGCTAACTACAAAAAAATAAAGAATTCTTTGAGCAACTT
CGTAAGCAGAGACCTCAAGGCTCTAAGTAATTTGATCCTTAAGAGTTTGAATAAATAGTT
CAATAAGCCAACTAAGAACCTGATAAAAAAGGAGTGAGAAACAGCTACAAAAATTCATCT
TAAGATTCTGGAATTCAAAGCTATTTACCTCAAGTAGATTAAGTAGTTGAAAATAATTTC
GAGTATCCTTAAAACCAAAGCAATCAAAACAGCACATTAGATTCCTACATTGAAAAAACA
ATAGATGAGTAGATTTATGAAGACAATAAAAATCTCTTTTTTTCAGAATTTTAAGATTTT
TAAGATAAGGAAGCTTTAATTGCTGAATTGTATTAGCAACTTCAAAAATTCCCAGATACT
AAAAAAATATAATATAAAAACAAATCTTTTTATGAAGGATAAGTTCAAGTTACAGACAGG
AGCATTGTTAGGTAAAAAGAAATATTTTTGAAAGCAAATTTATTTTTTAAAGTTTTAATT
AATTTGTTAGTTTGTTTTTGAGATTTTTTTTAACTATTAAAATATTTTTAGAAACGGATT
TGGAATCCTAAAAATGTAAAATGGGGACATTTATTGTGGTTATTTTAAGAACAACTAATT
CGATGGAGAGGGTGTTTATTTTTACAATCATGGAGATATTTACAGAGGCTAACTTCGCAA
AGATCTCAGATAAGGACACGGAACTTACTATTACCATGGATTAGGATTCATTTATTCTGG
GGAATGGAATGGAAACGTGAAAGAAGGCTACGGAAGACTTCTAATGAAAAACAAAGTGAA
ATTTATAATTTCAAAATATCAGAAAAAAATTAATTAAAATATTATAAAAATTATAGGAGA
AATATGAAGGCTATTTTAAATAGAATGTAAAATGTGGTAGAGGTATTTACTATTTTGCTA
ACGGGGATACATTTGATGGTGAATGGGTCTATGATAAGAAATGTGGATTTGGTACCTTAG
AGTTCAAGGATGGTAACCACTTCGAAGGTAATTTTTATGATGATCTTCCTTATGGCTAGG
GTTAAATGAAGTTTAAAAATGGGGATGAATATAGTGGAAACTATGAAGATGGATTAATTT
CTGGTTATGGTATTTACATACATGCCAATTAACAATACTATGAAGGAGATTTTAGTAAAA
ACTAAATGAATGGAGAAGGAATATATTATTTTAAAAATGGGGATAAGTATTAGGGATAAT
ATATAGATGGAATTCGAGAAGGTTATGGAAAGTATTTCTATTAAAATGGTTGTATCTACG
AAGGTTAATGGGTAAACAATTAAAAGCATGGTGAAGGAAGGTATATTTTCCCTGATAATA
CATATTACTAAGGTTCATTTGAAAATTCAATGAAGTCCGGAATAGGAAAATAAACATTTA
AAGGTATTTTTTACTAATAATTTTATTAAAATATTTAATATGTTTTTAATTAACATAAAA
TTTAGAAAATGAATTCTATAATGGGTAATGGAGAAATGATAAGAGAAATGGGAAGGGATT
TTATTAATTTAAAGATGGAAGCTACTATGAAGGAGATTGGCTAAATGACAAAATGCACGG
CGAAGGAACTTATAATCTCAAAACTAGTTCTGGCTTTAGAAAGATTTATGGAATTTGGAG
CGATGATGAACTTTATTAAAGTTTTGAATGA


>TTHERM_00013150(protein)
MQFEQLIENSTVKDLKINYKKDYRENYKLVRDETIYGLSVCKTYIQKNIKTNEMFLCVQE
TFYDHQSPKIINMLETLQVINENPFFNQFRAFSYEELQQKSVRIYILIEYYDMNLIKIAK
KRTLIDKNLIDSLTKCFLCSIQFLFKIESSLLAIHSSNVFLKQMSANINDGYLVKILYFP
FMQSSFDMVLSGKEKHYNCYLSVEELECLDKKLENIEINNTQSNIFSFGALLLDLLNCAN
PNANGISLIYCKDSYRIDETNFFERINFVAEKYPKRVFLLLEQLLKFNDRQTPRQIMKLY
ENQSQINNSQIADDTIANAKQRIQMQLYSEFPIKSNVVNSPSNYNFAQKQKQNTLNNNNN
SSEQQTFSNSAFQSNQEEPIYYNNNLSNNQNKINNEFQNNEFQDRKYNQQIQSPQDFQSN
KNNNQVINPLGSSSQFDQDSNRNQKTRSKWDIPSIHNSGSRQFNPIVTPFSNNQLSPTER
NEYANNIRYAEDSPTFANQNNISPSYQLSSESGNKNQQNSLYNQNSNNNDYNQFLFQSID
KDAEQKNRKFAVQGRGEDNQVVYKKQPDQISSEYFKPNNSSSNNQSQQFDFNFYNQIQND
NDKYMNKDLPSIQIQKVESNYENHSQQPNNNKNYDQQNSKFLLSPSSQFSNNDSSQQQYS
KEIPQAPQLPSAPSAQSQKGAKDDYQKNTIPQAPLLNENSHLKTPQVNTIPQAPSLNTIP
LAPPLNGIQVPKTNTIPPAPQLAGIPPAPFIGGIPPAPPIGGIPPAPPIGNTSQGSQLNG
IPPAPQINGIPKAPPLLNGIPSAPPMSILQEKNKNNQQPIQHLQSMIQNSLEVTDENNEQ
EQIRKKEEVLQRLFQNNNQAAPVRLPFFLPNQGVKKEIKDENNAKQADQKEEIKNDKNKE
LIGIPPAPQNLIPPPPPLPLSNILVDTNYVVKPKLEADTTVRDEQKERIENHKKTQNQLK
KESNDALLQSQSVLESSQRLIDKASKVKLPENQTYSTTILEEDENSANKKDTLDTYRTLK
ARENEYLNLKQQNLMKSQQQINLSKEEELKKIRNNHSQLLDNQNQHQQRSIENSVLNASN
KGDFYNNRKYQDGNNQIQNQNESQQQSNLYASFNPDSQEKSHDIHSFNENSVAVFDNEGS
LQNQHKLNFESIQNEREINHGGKDYNRQNDRSDLNDNQQFLSPQKKQNKVSSDYDLESYR
NEDNQSSWRFRQTPPQFQDGYGFENGITQYQMNNSQISNQDNNFRSSQIDQSAYKFPTNV
IQVINSIGGSLNQSSDQSSSIVQEAIRYNQQQEIIQQLYPNLNNSESRFQNRSEYLQESN
FQPNVYNNQYDGIQSSYQPQKNQFQQKNAQNQNNSPESTENTYNSYPYQKNNQNQPQNYQ
LNSPTTQLNSSQNNLNSSSYTPSSNFQKNSLYKNNDFIEEQSQESEPEEQNSLIYKSPIQ
KNVKDYMSQLQKNKEFFEQLRKQRPQGSKQFDPQEFEQIVQQANQEPDKKGVRNSYKNSS
QDSGIQSYLPQVDQVVENNFEYPQNQSNQNSTLDSYIEKTIDEQIYEDNKNLFFSEFQDF
QDKEALIAELYQQLQKFPDTKKIQYKNKSFYEGQVQVTDRSIVRNGFGILKMQNGDIYCG
YFKNNQFDGEGVYFYNHGDIYRGQLRKDLRQGHGTYYYHGLGFIYSGEWNGNVKEGYGRL
LMKNKEKYEGYFKQNVKCGRGIYYFANGDTFDGEWVYDKKCGFGTLEFKDGNHFEGNFYD
DLPYGQGQMKFKNGDEYSGNYEDGLISGYGIYIHANQQYYEGDFSKNQMNGEGIYYFKNG
DKYQGQYIDGIREGYGKYFYQNGCIYEGQWVNNQKHGEGRYIFPDNTYYQGSFENSMKSG
IGKQTFKENEFYNGQWRNDKRNGKGFYQFKDGSYYEGDWLNDKMHGEGTYNLKTSSGFRK
IYGIWSDDELYQSFE