Identifiers and Description

Gene Model Identifier

TTHERM_00013290

Standard Name

RAD23 (RADiation sensitive 23)

Aliases

PreTt11835 | 1.m00883

Description

RAD23 UV excision repair RAD23-like protein putative; UBA/TS-N domain containing protein; recognizes DNA damage in nucleotide excision repair; homolog of yeast RAD23

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02723.1 9.997093137033517e-262
Description: UBA/TS-N domain-containing protein (375 aa)
Oxytricha Contig21398.0.g83 5.0019039340728934e-39
Description: Ubiquitin family
WormBase WBGene00013924 7.001072473260973e-36
Description: locus:rad-23 status:Confirmed UniProt:Q23451 protein_id:CAA93780.2
DictyBase DDB_G0286357 7.002785992501305e-33
Description: rcbA on chromosome: 4 position 4412389 to 4414128
SGD YEL037C 4.000352986427571e-28
Description: RAD23 Protein with ubiquitin-like N terminus, subunit of Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that binds damaged DNA; enhances protein deglycosylation activity of Png1p; also involved, with Rad4p, in ubiquitylated protein turnover
Stentor Coeruleus SteCoe_24399 2.8625185805493937e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013290(coding)
ATGAAGATCAACATTAAGACTTTAAAGGGCACTGATTTTTTTGATGTTAACCTTGAAGAA
ACTGCTACAGTTGCTGAATTGAAGGAGAAGATTGCTACTGAAAAGTAAAAGGAAAAAGAT
ACTATTAAGTTAGTTCATAAAGGTAAATAATTGACCGAAGACTCTAAGACTCTTGGCGAA
CTTGGTATTAAAGATAATGATTTTGTTATTCTCATGTTCTTTTAAAAGAAAGCAGAAAAA
GAAGATGCTCCATAATAAGCTTAATCTGATACCACTTCTACTACCTCCGCTGCCTCAACA
ACTGCTACTAACCCCACTACTGTTCCTAAGCCTGCTGTTTCCTAACCCGCTACAACATAA
TAAACAGGAAGTTAAGGAACAGGTAGTGATCTCCTTTAAGGTCCTGAATTGGAAGCCAAA
ATTAAAGAAATTGAATCAATGGGTTTTGAAAGACCTAAGGTTCTTTAAGCTTTGAAGGCC
GCTTATTACAATCCTGAAAGAGCAGTTGATTATTTACTCAGTGGTAATATTCCTAAAGAA
CCTAGTTAATAATAGAGTCCTTTACAAGGCTTACAAGGTCCTGGTGTTGAATAATTAGCT
TAATTAGCTTAAAATCCTCAATTCCAACACATTGCTTAAGCTATTCGTTAAAACCCTGCT
CTTCTCCAACCTGTCATGTAATAATTAGCTTAAACTAACCCTGATGTTGCCAGACTTTTA
CAATAAAACCCTCAAGCTTTCTTGCAACTCCTCCTTGCTGCCTCTGAAAACGAAGGTGGA
TAAACCTTACCTCCAAATGCCATCCAAGTCACTCCTGAAGAAAAAGCTGATATTGATGAC
ATTATTTCTATGGGTTTTGATAAAAATGACGCCTTAGAAGCATATATTACCTGCGACAAG
AACAAAGAATTAGCAATTAACTATCTTTTCGAAGCAAGGGAAAGCGGTACTCTTCTTTCT
GAACACATCCAAAAGGAAGAATTAGAAGCTGCATAATAATAATCATAAAACTAAAATTAA
TAACAATAAGGTAATAACCCAAATCAATAATAATAATAAGGTGGATAAGGTGAAGGTGGT
GATAATGATGATGAAGATGACGATGATTTTATGTATTAATGA


>TTHERM_00013290(gene)
ATGAAGATCAACATTAAGACTTTAAAGGGCACTGATTTTTTTGATGTTAACCTTGAAGAA
ACTGCTACAGTAAATTTATTAAAATGTTTTGTTTTAGGAGAGCTCGAATTCTTGTTGACA
TTTTAAGAATTAGCTAGATAAATACTTGTTTTCAACATATTTTATAATCTTGTTAGGTTG
CTGAATTGAAGGAGAAGATTGCTACTGAAAAGTAAAAGGAAAAAGATACTATTAAGTTAG
TTCATAAAGGTAAATAATTGACCGAAGACTCTAAGACTCTTGGCGAACTTGGTATTAAAG
ATAATGATTTTGTTATTCTCATGTTCTTTTAAAAGGTAATATTATCTTAGTTTTAAGATT
TCTTCAAAATGCGGCTATCTATTTATTTCTCTTTCTATGTGTGCTTTCTTTTAATCATGA
TTAAATTAGAAAAATTCTTCAAAAAATGAAGTAAAATCAATATTTTCTTTGTCGAATTGT
ACACAATTTAATGTGACATGACACTGAAATCATCTTAGTGACTGTTAAGCATTTTAATAG
ATGAATAATAGATAAAGTAGCATAGAAAGCAGAGAAAATTTTATGGCTAGCATTTAATGA
AAGAAAGAAAGAAAGAATGAAATTGCAATTATAATTTAAAAAATAATAAACTAAATATAA
CATTATTATAGAAAGCAGAAAAAGAAGATGCTCCATAATAAGCTTAATCTGATACCACTT
CTACTACCTCCGCTGCCTCAACAACTGCTACTAACCCCACTACTGTTCCTAAGCCTGCTG
TTTCCTAACCCGCTACAACATAATAAACAGGAAGTTAAGGAACAGGTAGTGATCTCCTTT
AAGGTCCTGAATTGGAAGCCAAAATTAAAGAAATTGAATCAATGGGTTTTGAAAGACCTA
AGGTTCTTTAAGCTTTGAAGGCCGCTTATTACAATCCTGAAAGAGCAGTTGATTATTTAC
TCAGTGGTAATATTCCTAAAGAACCTAGTTAATAATAGAGTCCTTTACAAGGCTTACAAG
GTCCTGGTGTTGAATAATTAGCTTAATTAGCTTAAAATCCTCAATTCCAACACATTGCTT
AAGCTATTCGTTAAAACCCTGCTCTTCTCCAACCTGTCATGTAATAATTAGCTTAAACTA
ACCCTGATGTTGCCAGACTTTTACAATAAAACCCTCAAGCTTTCTTGCAACTCCTCCTTG
CTGCCTCTGAAAACGAAGGTGGATAAAGTAATAATTTTAAATTGTTAATTTTTCATGGAC
TTTAAATGCTAAAATAATTGACAAAAGAAAGTCTTTTACTTTTCCATTAAAGACAAAAAG
AATATAAATTCTTGTATCTGTCTTTCTTTCTTTCTATCTATTTATCTTTCTATTGATTGA
TTTAAATAATCTGATCTGATTAAAGAAAATAGAAAAGAGCAGAATTGATTAGTTAGCATA
TCTTCTTCGTTTTTCTATTTATTTTTTAATAAAAATTAATCTTTAAAATTAATTAGCCTT
ACCTCCAAATGCCATCCAAGTCACTCCTGAAGAAAAAGCTGATATTGATGACATTATTTC
TATGGGTTTTGATAAAAATGACGCCTTAGAAGCATATATTACCTGCGACAAGAACAAAGA
ATTAGCAATTAACTATCTTTTCGAAGCAAGGGAAAGCGGTACTCTTCTTTGTAAGAAATA
TTAACTTTTTTTTTTTTAATTCAAGAAAGCAAGCAAGTTTAAAAAAGCAATTGTGTATAT
AAATAAATCATTAAATTAAAATAAGAAATAGTTGAAAAAAAAGATATTCATTCATCCATT
CACATAGTAAATATTCTAAATAAATTTTTATTTAATTAAATAGCTGAACACATCCAAAAG
GAAGAATTAGAAGCTGCATAATAATAATCATAAAACTAAAATTAATAACAATAAGGTAAT
AACCCAAATCAATAATAATAATAAGGTGGATAAGGTGAAGGTGGTGATAATGATGATGAA
GATGACGATGATTTTATGTATTAATGA


>TTHERM_00013290(protein)
MKINIKTLKGTDFFDVNLEETATVAELKEKIATEKQKEKDTIKLVHKGKQLTEDSKTLGE
LGIKDNDFVILMFFQKKAEKEDAPQQAQSDTTSTTSAASTTATNPTTVPKPAVSQPATTQ
QTGSQGTGSDLLQGPELEAKIKEIESMGFERPKVLQALKAAYYNPERAVDYLLSGNIPKE
PSQQQSPLQGLQGPGVEQLAQLAQNPQFQHIAQAIRQNPALLQPVMQQLAQTNPDVARLL
QQNPQAFLQLLLAASENEGGQTLPPNAIQVTPEEKADIDDIISMGFDKNDALEAYITCDK
NKELAINYLFEARESGTLLSEHIQKEELEAAQQQSQNQNQQQQGNNPNQQQQQGGQGEGG
DNDDEDDDDFMYQ