Identifiers and Description

Gene Model Identifier

TTHERM_000207258

Standard Name

RAB47 (RAB GTPase 47)

Aliases

None

Description

hypothetical protein; Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_5097 0
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000207258(coding)
ATGTAGGAAAGTCATCTTTATATTAGAGATATGATTAAGGAAAGTTTATTAACTCTCTTA
ATTTAAGCGTCCTCGATTTTTACTCAAAAACTATTAAGTTAGGAGAGGAACAAATTAAAT
TTTAATTTTGGGATTATCAATCTTGCCAAAGAGAAGTTTCTTTATCACAAATTTTTTATA
AATAATGCTCAATAGTTATGA


>TTHERM_000207258(gene)
ATGTAGGAAAGTCATCTTTATATTAGAGATATGATTAAGGAAAGTTTATTAACTCTCTTA
ATTTAAGCGTCCTCGATTTTTACTCAAAAACTATTAAGTTAGTAAAAATTAATTATTCTA
CAAAATCTAAATAAAAATGTTTGACATTATTTTTAATAGGGAGAGGAACAAATTAAATTT
TAATTTTGGGATTATCAATCTTGCCAAAGAGAAGTTTCTTTATCACAAATTTTTTATAAA
TAATGCTCAATAGTTATGA


>TTHERM_000207258(protein)
MQESHLYIRDMIKESLLTLLIQASSIFTQKLLSQERNKLNFNFGIINLAKEKFLYHKFFI
NNAQQL