Identifiers and Description

Gene Model Identifier

TTHERM_00023980

Standard Name

RAN1 (RAN GTPase)

Aliases

Tt-ran | PreTt12011 | 1.m01059

Description

RAN1 GTP-binding nuclear protein Ran-1; Putative Ran GTPase; an evolutionarily conserved small GTPase with roles in nuclear transport- mitotic spindle assembly and nuclear envelope assembly

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13865.1 2.0007442334946695e-153
Description: Ras family protein (241 aa)
Oxytricha Contig21120.0.g73 3.001222955304439e-106
Description: Ras family
SGD YOR185C 7.003003394656772e-98
Description: GSP2 GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog that is not required for viability
WormBase WBGene00004302 9.003233894748109e-95
Description: locus:ran-1 GTP-binding nuclear protein ran-1 status:Confirmed UniProt:O17915 protein_id:CAB07240.1
DictyBase DDB_G0291235 9.998285701479858e-93
Description: ranA on chromosome: 6 position 78789 to 80092
Stentor Coeruleus SteCoe_37736 5.0345753587649823e-45
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22594798: Liang H, Xu J, Zhao D, Tian H, Yang X, Liang A, Wang W (2012) Subcellular localization and role of Ran1 in Tetrahymena thermophila amitotic macronucleus. The FEBS journal 279(14):2520-33
  2. Ref:12787777: Quimby BB and Dasso M (2003) The small GTPase Ran: interpreting the signs. Curr Opin Cell Biol 15(3):338-44
  3. Ref:8026746: Nagata K, Takemasa T, Alam S, Hattori T, Watanabe Y, Nozawa Y (1994) Cloning of cDNAs encoding a cell-cycle-regulatory GTP-binding low-M(r) (GBLM) protein, Ran/TC4, from micronucleated Tetrahymena thermophila and amicronucleated Tetrahymena pyriformis. Gene 144(1):123-5

Sequences

>TTHERM_00023980(coding)
ATGGTTGATAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGATGGT
GGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGATAT
ATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCCATC
AGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGTTAC
TACATTGGTGCCAACGCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAA
AATATTCCTAAGTGGCACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTG
GTCGGTAACAAGGTTGACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCAC
AGAAAGAGATCCCTCTAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAG
CCCTTCCTCTGGATCCTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGT
ATCGCTCTTGTTGCTCCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTG
GAAATGGAACAAGCTGAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAA
GATGATGAATTCAACTGA


>TTHERM_00023980(gene)
ATGGTTGATGTAAATAGTATTTTTTATTCTTTCTTTCTGGCTCAGGAACTGATCTTCAGT
TTTCTTGGATGATGGACACATAGTCTATGAACCTATCATGATTGTTTGTTGATCTCTTTC
CTAAGCCAGAGAGGATTGATTGTTTGCTAATACCTTATTGCTAAACTAACTTTTACAATT
TTAAAATAATAGAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGAT
GGTGGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGA
TATATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCC
ATCAGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGT
TACTAGTAATAATTTTTTTCAAACACTTATCATAAAATTTTTATCATTTGGACTAATTGA
TTGACTGACTGACTGATTAACAAGTTTGTTTGCTGAATAATTGCTTACAAGTCTAACTAG
CTCTTACTATAAATATTCCTTTAGGCTCTGTGTTTGTTCATAACATATAAATAGGAATGT
GAGTCATTCTTTCTTTCTATCTATTTTGTTTATGTTATCAAGCTACAAAGCAAGAGTTGA
TTGCTAAAAATAAGCAACAAGAAATAGAAAGATGATTATTAAATGGTATAAAAGGAATAG
CAGAGACCATCTACATTGATTAAGCCATAGCTTCTTACATTATAAGAAATTATAAAGAAA
GTAGGATGCATTTAGAGAAGATTTAGCTAGCGAAAACCCAATCTTTTGTGGTGATTTATT
TAGCGACGCAATTTAATTTAAAAAGAAAATTTAAAAACAAACTCAGTCTGTCAATCAGTC
AATCAATCAGTCAGTCAGTTCTTTGTTCGTTGAGACTCTTTTTTCATTTAAAAATGCTTA
AATCAATCTATTTAACGAATTTCTAATGAATTTATTTTTAACAATAGCATTGGTGCCAAC
GCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAAAATATTCCTAAGTGG
CACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTGGTCGGTAACAAGGTT
GACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCACAGAAAGAGATCCCTC
TAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAGCCCTTCCTCTGGATC
CTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGTATCGCTCTTGTTGCT
CCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTGGAAATGGAACAAGCT
GAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAAGATGATGAATTCAAC
TGA


>TTHERM_00023980(protein)
MVDNKQNVVAEFKLVLVGDGGVGKTTFVTRHQTGEFEKRYIATQGVNVSNMVLYTTKGPI
RFNIWDTAGQEKLGGLREGYYIGANAAIMMFDVTSRITYKNIPKWHKDLTRICENIPIVL
VGNKVDSKDRKVKARQITFHRKRSLQYYDVSAKSNYQYEKPFLWILRKLTGDPTLNLVEG
IALVAPDTEHVMTEDQIKQLEMEQAEAMNLAQQGVLPDDEDDEFN