Identifiers and Description

Gene Model Identifier

TTHERM_00030210

Standard Name

LC7B

Aliases

PreTt14252 | 2.m02399 | 3825.m02639

Description

LC7B dynein light chain roadblock-type 2 protein; Dynein light chain 2B- cytoplasmic- putative- Light chain subunit of ciliary three-headed outer arm dynein (OAD)- two-headed inner arm dynein (IAD) complex 1- and non-axonemal dynein complex 1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00811.1 4.001968334034435e-68
Description: dynein light chain 2B, cytoplasmic (104 aa)
Oxytricha Contig16690.0.g70 2.999534586690157e-23
Description: Roadblock/LC7 domain
WormBase WBGene00012004 4.997543945741262e-17
Description: locus:dyrb-1 status:Confirmed UniProt:Q22752 protein_id:CAA90946.1
DictyBase DDB_G0285855 0.000000000000020000882446601127
Description: dlcC on chromosome: 4 position 3725623 to 3726100

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00030210(coding)
ATGATCTATAAAACTTCAAAAGAAATTTAAAAGAGTGACTAAAGAATAATTTAATAAAGA
GTAGAGAATTCAATTATTAATAATCAAATATATCAAAAATCTCTTAAGCGAAAAACAAGC
AAAAGAAAAGTAAGGCACTAAGCAAACAAAAAAAATTTTTAAAAAGAAATGTCTGAAGTT
GAGGATACTTTAAATAGAATAAAGACACATAAAACAGTTTTAGGCTACTTGATTGTTAAT
AGTGAAGGTGGTGTTGTTAGAGGTGCCTTTAAGGATGAGGAAGAAAGCAAAAATATCGCA
AATTCAATTCCTCTACTCACAAAAAAGGCTCGCTCTGTTGTAAGAGACTTAGACCCTACA
AATGATTTAGTTTTCTTGCGTATATAAACTAAGCTTAATGAGATTATGGTTGCTCCTGAT
GATGAATTCTCTTTAATCGTAATATAAACTAAAGGTGAAAAGCGTGATGAAAACGATTGA


>TTHERM_00030210(gene)
ATGATCTATAAAACTTCAAAAGAAATTTAAAAGAGTGACTAAAGAATAATTTAATAAAGA
GTAGAGAATTCAATTATTAATAATCAAATATATCAAAAATCTCTTAAGCGAAAAACAAGC
AAAAGAAAAGTAAGGCACTAAGCAAACAAAAAAAATTTTTAAAAAGAAATGTCTGAAGTT
GAGGATACTTTAAATAGAATAAAGACACATAAAACAGTTTTAGGCTACTTGATTGTTAAT
AGTGAAGGTGGTGTTGTTAGAGGTGCCTTTAAGGATGAGGAAGAAAGCAAAAATATCGCA
AATTCAATTCCTCTACTCACAAAAAAGGCTCGCTCTGTTGTAAGAGACTTAGACCCTACA
AATGATTTAGTTTTCTTGCGTATATAAACTAAGCTTAATGAGATTATGGTTGCTCCTGAT
GATGAATTCTCTTTAATCGTAATATAAACTAAAGGTGAAAAGCGTGATGAAAACGATTGA


>TTHERM_00030210(protein)
MIYKTSKEIQKSDQRIIQQRVENSIINNQIYQKSLKRKTSKRKVRHQANKKNFQKEMSEV
EDTLNRIKTHKTVLGYLIVNSEGGVVRGAFKDEEESKNIANSIPLLTKKARSVVRDLDPT
NDLVFLRIQTKLNEIMVAPDDEFSLIVIQTKGEKRDEND