Identifiers and Description

Gene Model Identifier

TTHERM_00031680

Standard Name

THD7 (Tetrahymena Histone Deacetylase 7)

Aliases

PreTt14300 | 2.m02084 | 3825.m02684 | NDT1

Description

THD7 Zn-finger in ubiquitin-hydrolase; Zn-finger in ubiquitin-hydrolases and other protein; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00865.1 8.003007177279125e-133
Description: Zn-finger in ubiquitin-hydrolase (277 aa)
WormBase WBGene00018319 2.000769134519826e-18
Description: locus:hda-6 status:Confirmed UniProt:G8JYB7 protein_id:CCD71107.1
DictyBase DDB_G0283917 4.997543945741262e-17
Description: sir2A on chromosome: 4 position 1272110 to 1273864
Oxytricha Contig18612.0.g7 0.000000000000001999258566166494
Description: Zn-finger in ubiquitin-hydrolases and other protein
Stentor Coeruleus SteCoe_28457 0.0000000000006914400106940203
Description: None
SGD YBR058C 0.00000030014504373857585
Description: UBP14 Ubiquitin-specific protease that specifically disassembles unanchored ubiquitin chains; involved in fructose-1,6-bisphosphatase (Fbp1p) degradation; similar to human isopeptidase T

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00031680(coding)
ATGATAAATTTATAGGCAGGATAGGCTTTTATAGATCCATTTACAGGCGAAGAAGCATTT
GCAGTAGAACCTATTACTAATTGTCCACACGCTCTAAAGCTAGATTTGAAAAAAACAGAA
GAGACTATTTATCAGAAAAGATAATAGTTATTTTGGAGTTAATGTAGCAATTGTGAAAAT
GTTGGTGAAAATTGGTTTTGCTTAATTTGTAATAACGTCTATTGCAGTAGGTATGTTAAA
GGTCATATGGCTATGCATAATTAATAGAATTAAGATCATTAAGTTGCTGTTAGTTTTTCT
GATTTAAGCTTTTGGTGTTACGAATGTGATTCTTATATAACAAATTAAGACCTTTCCAAG
TTGAGAAAATTATTTTAAAAGGCTAAATTTAATGAAGGAGATTTTTCTTAAAAGCAGAAT
TTAGTATCATAAAGTGATAAGAATCATGAAGAAATTAGTTAAAAAGCCATCAACGGTAAT
GGATTTTTTGTAGCAGGAGATATTAAAGAATAAAAGGTTTATTAAGTACTAATTTTAAGT
TAGTTTTAGAAAGATATAATTGTGTAAAAAGGAGTGTTAAAGGGATATTAAATTTAAAAT
AGTAAAAGTAATTATGCTTAACAAATTATAAAAAATGAAAGTGAAGAAGTTTTGGGATCT
GTTATAAGATTTGGAAAAAATTTGGAGCAAGTAACCAGAGAAAAGATAGCCTATTTAATG
AATGAAATAGAAGGATTTCCCATTCACACTTCAATTAAATTTGAAAAAGTAATTTCTGGA
GAAGAATAATTAGAGTTAGCTATTTATTGCTTAGATGATTGA


>TTHERM_00031680(gene)
ATGATAAATTTATAGGCAGGATAGGCTTTTATAGATCCATTTACAGGCGAAGAAGCATTT
GCAGTAGAACCTATTACTAATTGTCCACACGCTCTAAAGCTAGATTTGAAAAAAACAGAA
GAGACTATTTATCAGAAAAGATAATAGTTATTTTGGAGTTAATGTAGCAATTGTGAAAAT
GTTGGTGAAAATTGGTTTTGCTTAATTTGTAATAACGTCTATTGCAGTAGGTATGTTAAA
GGTCATATGGCTATGCATAATTAATAGAATTAAGATCATTAAGTTGCTGTTAGTTTTTCT
GATTTAAGCTTTTGGTGTTACGAATGTGATTCTTATATAACAAATTAAGACCTTTCCAAG
TTGAGAAAATTATTTTAAAAGGCTAAATTTAATGAAGTAAGTAAATTAAATGTTTTATTA
TTAAAATTAATTTTAGCTGTTTATTACATTAAATATTTTATTTACATTATTAAGTATTCA
TTTTTTAAATAACAATTTCTATAAAATCATATGTTTTTAAACATGAACATCAAAATTAAA
TCAAAAATAGGGAGATTTTTCTTAAAAGCAGAATTTAGTATCATAAAGTGATAAGAATCA
TGAAGAAATTAGTTAAAAAGCCATCAACGGTAATGGATTTTTTGTAGCAGGAGATATTAA
AGAATAAAAGGTTTATTAAGTACTAATTTTAAGTTAGTTTTAGAAAGATATAATTGTGTA
AAAAGGAGTGTTAAAGGGATATTAAATTTAAAATAGTAAAAGTAATTATGCTTAACAAAT
TATAAAAAATGAAAGTGAAGAAGTTTTGGGATCTGTTATAAGATTTGGAAAAAATTTGGA
GCAAGTAACCAGAGAAAAGATAGCCTATTTAATGAATGAAATAGAAGGATTTCCCATTCA
CACTTCAATTAAATTTGAAAAAGTAATTTCTGGAGAAGAATAATTAGAGTTAGCTATTTA
TTGCTTAGATGATTGA


>TTHERM_00031680(protein)
MINLQAGQAFIDPFTGEEAFAVEPITNCPHALKLDLKKTEETIYQKRQQLFWSQCSNCEN
VGENWFCLICNNVYCSRYVKGHMAMHNQQNQDHQVAVSFSDLSFWCYECDSYITNQDLSK
LRKLFQKAKFNEGDFSQKQNLVSQSDKNHEEISQKAINGNGFFVAGDIKEQKVYQVLILS
QFQKDIIVQKGVLKGYQIQNSKSNYAQQIIKNESEEVLGSVIRFGKNLEQVTREKIAYLM
NEIEGFPIHTSIKFEKVISGEEQLELAIYCLDD