Identifiers and Description

Gene Model Identifier

TTHERM_00036980

Standard Name

DRH6 (DExD/H box RNA helicase 6)

Aliases

PreTt14433 | 2.m02154 | 3825.m02806

Description

DRH6 type III restriction enzyme res subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00959.1 9.997093137033517e-262
Description: type III restriction enzyme, res subunit protein (439 aa)
Oxytricha Contig12363.0.g65 7.998157153133101e-120
Description: DEAD/DEAH box helicase
DictyBase DDB_G0270396 1.0001900614163146e-108
Description: ddx49 on chromosome: 1 position 4752654 to 4754329
WormBase WBGene00012059 7.996627236682682e-106
Description: Putative ATP-dependent RNA helicase T26G10.1 status:Confirmed UniProt:P34580 protein_id:CAA82362.1
SGD YHR065C 3.000425225396195e-97
Description: RRP3 Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity
Stentor Coeruleus SteCoe_16450 1.5007857627073948e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00036980(coding)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGCTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATT
TTGTAAGATTTAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGA
GAATTGGCTATGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGA
GTCTCCACTTTAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATT
CCTCATATTGTTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTT
CTAAAAGAATATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTT
GAGGATTCTATTATTGAAGATATATAATCAATTTTAGAGTTTATACCATAAGAGAAATAA
ATTATTCTAGCTACTGCTACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATA
TTAAAAACTAATGTGAAATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAA
ACATTAAAGCAAAAATTCGTCTTAGTCCCAGAAATGGTGAAAGATTAAAATTTCATCAAT
TTATTGAATAAATTCAAAGGAATTAGTATGATAATATTTGTAAATAAATGCAGAACTTGC
CATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTCATCTACTAGCTTGCATTCTGGT
TTAAAATAGGGATAAAGAATATCACACTTAAAGACTTTTAAAAGCCAAGCTGCAAATATT
TTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATATACCTACAGTTGACTTAGTTATT
AATTATGATATACCTAAAAATTCTGATGATTATATTCACAGAGTAGGTAGAACTGCTCGT
AAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACAATATGATGTACAGCTTATTCTC
AATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATTAAAAGTAGATGAAGAAGAAGCA
CTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTTTGTTAAAATTAAAATGTCTGAA
GATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTACAAAGAATTC
ATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGAAGAAAAATAA
TGA


>TTHERM_00036980(gene)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGGTAATTATTATAAATTAAAAAATATTATAAAAGCTTGAAATAGTTTTTAG
ATTAAAGCAAATTTCATTATGAGGTTTTATTAATACAATTTAAATTTAAAACTAATTTAG
CTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATTTTGTAAGATT
TAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGAGAATTGGCTA
TGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGAGTCTCCACTT
TAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATTCCTCATATTG
TTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTTCTAAAAGAAT
ATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTTGAGGATTCTA
TTATTGAAGATATATAATCAGTAAATTTTAGTTTAAGGCATAGCATTTAATTCATATTTT
TAATGATAAAAAGATTTTAGAGTTTATACCATAAGAGAAATAAATTATTCTAGCTACTGC
TACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATATTAAAAACTAATGTGAA
ATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAAACATTAAAGCAAGTAAC
TTATTTATTTATTTATATTTTAAAAATAAATAGTGATTTATTGATTATTCATTCTTAGAT
AAAGCATTTTACATTATAGAGTGTGAACTTAATTATAATTTAATCAATTACTATGATAAT
CATGCAATTTTCTAAAATTATTTATTAAAAAAAGAAATTCGTCTTAGTCCCAGAAATGGT
GAAAGATTAAAATTTCATCAATTTATTGAATAAATTCAAAGGAATTAGTATGATAATATT
TGTAAATAAATGCAGAACTTGCCATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTC
ATCTACTAGCTTGCATTCTGGTTTAAAATAGGGATAAAGAATATCACACTTAAAGACTTT
TAAAAGCCAAGCTGCAAATATTTTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATAT
ACCTACAGTTGACTTAGTTATTAATTATGATATACCTAAAAATTCTGATGATTATATTCA
CAGAGTAGGTAGAACTGCTCGTAAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACA
ATATGATGTACAGCTTATTCTCAATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATT
AAAAGTAGATGAAGAAGAAGCACTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTT
TGTTAAAATTGTAAGCAATTAAATTTTTTGAAATATTATTAATAATTTTTTTAATAAGAA
AATGTCTGAAGATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTA
CAAAGAATTCATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGA
AGAAAAATAATGA


>TTHERM_00036980(protein)
MHPFAKLGLDSWIQKTCDKVGYQNPTKIQELAIPPLLRKQHVIANAETGSGKTATFAFPI
LQDLAKDPFGVFAIVLTANRELAMQISEQFTIFGSSLNLRVSTLVGGVDFNKQLSELERI
PHIVVGTPGRTLDMIDKSPVLKEYIENVKYLVLDEADRLFEDSIIEDIQSILEFIPQEKQ
IILATATINDDFNDKKLNEILKTNVKFERFCVNQQKKVVQTLKQKFVLVPEMVKDQNFIN
LLNKFKGISMIIFVNKCRTCHFINALLNQLEFSSTSLHSGLKQGQRISHLKTFKSQAANI
LVATDVASRGLDIPTVDLVINYDIPKNSDDYIHRVGRTARKGKRGLAISIMTQYDVQLIL
NIEKNIGEKLEELKVDEEEALEIAPKVNKAKKFVKIKMSEDGSSENFDKQEQDKKSYKEF
IREQKKLKKVENNKIQEEKQ