Identifiers and Description

Gene Model Identifier

TTHERM_00037340

Standard Name

RPC1 (RNA polymerase III largest subunit Rpc1)

Aliases

PreTt14469 | 2.m02145 | 3825.m02839

Description

RPC1 DNA-directed RNA polymerase; RNA polymerase III largest subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_37735 0
Description: None
WormBase WBGene00004411 9.997093137033517e-262
Description: locus:rpc-1 DNA-directed RNA polymerase status:Partially_confirmed UniProt:Q18566 protein_id:CCD66619.1
Tetrahymena borealis EI9_00989.1 9.997093137033517e-262
Description: RNA polymerase Rpb1, domain 2 family protein (1437 aa)
DictyBase DDB_G0277199 9.997093137033517e-262
Description: rpc1 on chromosome: 2 position 7733653 to 7738100
Oxytricha Contig21914.0.g47 9.997093137033517e-262
Description: RNA polymerase Rpb1, domain 5
SGD YOR116C 9.997093137033517e-262
Description: RPO31 RNA polymerase III largest subunit C160, part of core enzyme; similar to bacterial beta-prime subunit and to RPA190 and RPO21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037340(coding)
ATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTTAAAGGAGACTAAAAGAATTGGTAGC
ATCCAATACAGTATCTTATCTACTAATGAAATTATAGATATGTCTGAAGTGTGCCTTGAT
GAGCCTTCTTTTTATAATTAAACTACTCGTGCACCTTTAAATCGTGGTCCCTTAGATTTA
AGAATGGGTCCTTCAATGCGTGAAAATAATTTGAAATGTCAAACATGTAATTAAGAAATG
TTGGAATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTCTACCAATATTCCATATAGGT
TTTTTTGGTGATGTCATTAACATCCTTTAATGTATTTGCAAGAGTTGTGGTAAGGTTTTG
CTGGATGAAGATGAAAAGAAGAACTCAATGAAAAGAATGCAAAAAGCTATTGATGACAAA
AATTATCAATTAAGAGCTGATTTGTATGTAAAAATGAGAAAAGAATGCAAAAAAGGTGCC
AACTAAAAATGTAGGTCTTGTGGATATAAAAACGGACCCTTAAAGAAAATGCCTAAAATG
CCTACAACTATTAGTTTTTCTGATCAAACCAAATTAGAATAGGATTTTCGTGACATTAGA
GAATCTGAAGACATATTTTAAGAGAATTTAAGAAAAATTTTGGAAAGTAAAAATATGAAG
GAAATGATTGAAATATTAAATCCTTTAGAAACCTATAAAATTTTCAGAAAAATTACATGT
GATGAAATTTTATTATTTAATATTCAATAAAACCATCCTTGTGATTTAATTCTCACTCAT
ATCATAGCACCCCCAGCTTGTATAAGACCAACTGTTAAAGAAGGAGAATCTAATGTTCGT
CACGATGATCTCACTGTTAAAATTAGAGATTTTTTGGACAGAAATAAAAGAATTGCTTAG
ATGATAGAAGATGGTGAAGATTTAATTAAAATTAACTAAGAGTGGTTCTTACTTTAGTGT
TCACATGCTCACTATTTGAATGCTGAAACTCCAAACTTGCCTTTTAAAATGGACAAAGAT
TTTGGTAAAAAGGATATTAGAGCACTTGCACAAAGATTAAAAGGTAAAAAAGGTAGATTC
AGAGGTAATCTTTCTGGTAAAAGATCAAACTTTACAGGTAGAACTGTTATTTCTCCTGAC
CCTAACATCCCTATTGATAATGTTGTTGTTCCTGAATACATGGCTAAAATTCTCACTTTC
CCTGAATAAGTTAATGCTATCAATATCGAAAGATTAAAAAAATTAGTTATAAATGGACCT
GAAAAATATCCAGGAGCTCATTATATAATAGCAAAAGACACAGAAGACAAATTTAATCTA
TCAATAGATAATAGAAGAAAGAAAGCAGATGAACTCAAGATTGGTGATATTGTAGAAAGA
CACATCCAAAACGGAGAAATTTTACTTTTTAATAGACAGCCTTCTTTGCATAGAATTTCA
ATTATGGCATTCAAGGCCAATATATAAAAATGGAATACAATCAGATTTAATGAATGTTGC
TGTGCTCCTTTCAATGCTGATTTTGATGGTGATGAAATGAATATTCATGTTCCATAAACA
ATAGAAGCAAGAGCTGAGGCCTAATATCTCCTTGATGTTAAACAAAATTTAATCAGTCCT
AAAAATGGTGAGTCAATTATTGCATTGATTTAGGATTTCTTAACTACTGCTTATTTAATC
ACTCATAAAGATATGTTTTTTGATAGAGCTGCTTTTTGCTAATGCTGTACTTACTTCAGT
GATGGTATTGAAAGAATTGATTTGCCTCCTCCAGCTATCATACTTCCTGTTGAAATGTGG
ACTGGAAAATAAATTATAGATGTCATCCTAAGACCTAATAGATTTAGCAATATTATTGTT
AATCTTATATTAAAAGAAAAATGCTACGATACTAAGTAAGATAGAGGTGTTATGTGTCCC
ACTGATGGTTATGTAGTCTTTCAATCATCTGAATTAATGTGTGGTAATCTTGGTAAAACT
ACTTTAGGTTCTGGTAATAAAAATGGTTTGTTTTACAGATTAAGTAGAGATAATTCTCAA
TACATGGCTGCATCAGTCATGAGTAGATTTGCAAAATTGTCTGCTCGTTGGATTACAAAT
TATGGCATGACAATTGGTATTAGTGATGTTACTCCTTCTCCAAGTCTCAACAAAATTAAT
GAAAAAAAGAAAGATGAAGCCATCGATTCTTGTAAGTTCCAAAGTCTTATTTTCACAAAT
TCTATTGGAAAACTAGATATGCAAACTGTTTCAGACAGAAAAAAGCTTGTAGAAGCTGAA
ATTAGTAAAACTTTGAATCAAGTCAGAGAAGACATAGGTTCAAATTGTAATAAGTAATTA
CCACCTACTAATGGTCCTCTTATTATGGCTACATGTGGTTCAAAGGGTTCAGCAACCAAC
CTTTCTTAAATGATTGGATGTGTCGGTTAATAAATTATTGGTGGTCGAAGAGTTCCTAAT
GGCTTTACTGGGCGTACTCTTCCTCATTTTGAAAAAGATGAAATATTCCCTCATCCAGAA
GCTATGGGTTTCGTTAGAAATTCCTTCTTTACTGGTTTAAGTGCACCAGAATTTTTCTTC
CACACAATGGCTGGTCGTGAATCTCTTGTTGATACTGCTGTCAAAACTGCAGATACAGGT
TATATGAGTAGAAGATTGGTTAAGATGCTTGAAGATTTATCTGTAAACTATGATCTTACA
ATTAGAACTTGTGATAAAAAAGAATTAGTTCAGTTTAGATATGGTGGTGATGGTATTTGT
CCTTGGATGTCAGAAGAAAAAGTAACTGATAAAAGTATTCCAATAGATCTTGAAACTATG
TTAAAATATGTCAAATCAATAGCTCCCATAAATTATAAGAGAGAGTAATCCTTGTATCCT
TATTAAATTTATCAAATCTGTTTGGAAGAATTAAAAAGAACAAAAATGGATTATATTCCA
GAATTAAGTTTAGAACCTATGTAAAACTCATCTTATAATAGAGAATTCGACTAAGATTAC
ATACAATAATAATTGAATAGTACAGATAACAAGTTTGATGTCCAACTAGTAAAAGAGCCC
TTAGAGTACTTTAAAGACTCAGTAAGTCTATTTATCAAGTAGATATGCTAAAAAATTATG
AAAGTGAGAACTTAACTTGGATTAACTCCTGGTGATATTGAGTCACCTGATAATGCTACT
AGCATCCATGTTGATAATACAATTCATATTACTAAAAGACAAATTAATTACTTCTTTAAA
ACTTTGTGGGAAAGATATCCATAGATGCTTGTTGAACCAGGAGAGGCTGTAGGTGCAGTT
GGTGCAACATCAATATCTGAACCAGCTACTTAAATGACTTTAAAATCTTTTCACTTTGCT
GGTGTTGCGAGTATGAATATTACATAGGGTGTTCCAAGAATGAAAGAAATCATTGATGCT
GCTAAGAAAATTAGCACTCCAATCATAGATGTTAAGTTGCTTCCTCAATTTTAGAGTGAG
CACTCTTATAGATCAATTCGTTTACAAATAGAAAAAACTTATCTTGGTGAAATCAGTAAC
TTCTATCAAGAAGTTTACTCTCCTAAAGATTGCCACCTTTACATAGAGTATAATAAGAAA
AAATTGGAATAATTCAGACTTTATGGATTAGAAATACCTTTATCAAGCATTAAAAAAGGT
ATTCTTGAAATTGCTAAAGATATAAAGGAAGATTAAATTATTGCCGTAAAGGATTAAGAT
CTCAAGCCTGTTGGTATTAAAATCAACCCAGGTAATGATGTCAAGAAGAACGTGTTCTTT
AAAATTTAAAACTGGAAAAAGATACTTCCAGGAGCTGTTGTTTCAGGTATGAAGGATGTA
AAGAGAGTAAGTATCTCAAAAGACAAGAAGAAGGGAGATAAAAATGAGTACAAATTCGAT
TTGTTTGTTGAAGGTAATTCTTTTAAATAAGTTTTACAACTTGATGAGGTAGATTTTGCA
AATACTCTTTCTGTTGATATTTTCGAAGTATTACAAATTTTGGGTGTAGAAGCTGCAAGA
AAGACAATTATAAATGAAATTACTAAAACTATCAAATCCCACTCTCTTAATGTCGATAGA
CGTCACTTGATTTTAGTTGCCGATGTCCTTACTTCTAAGGGTCGCTTACATGGCTCAACC
AGATAGGGAATCAATAGTATGAAAGACTCAACTTTGATGTTGGCTTCATTCGAAAAAACT
ACTGAAATCTTATACAACGCTGCCTTATAGGGAAGAAAAGACACTTTAGAAGGTGTATCT
GAAAGAATTATTATTGGTCAAAATATTCCTATGGGAACAGGTACATTTAATTTGCTTTAT
GGAAACAGAAGTATTGTTCAGAAAAAGAAGAAGAAAATTATATCTTCTAAAGTTAAATTT
ACTCCTCTTTTTAAAGATTCAAAATGA


>TTHERM_00037340(gene)
ATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTTAAAGGAGACTAAAAGAATGTAAATA
TTAGAATCGAGTTCATAAATCTTACATTTTTTTATTTTTTAATTCGTTTGCCAAATATAT
TTTAAGATGATTGAAAATTGAATTAAATGATAAAATTCATTCACTAATCTTTCAAAATGC
TAATTTGTTTATTTTTTTATTTAAAACATATATTAGTGGTAGCATCCAATACAGTATCTT
ATCTACTAATGAAATTATAGATATGTCTGAAGTGTGCCTTGATGAGCCTTCTTTTTATAA
TTAAACTACTCGTGCACCTTTAAATCGTGGTCCCTTAGATTTAAGAATGGTAGAATATTG
AATTAGTTTAGGAAATAAGCTTTTAAAAAAACAAACAAATAAACCATTTGGCAAATATTT
TAAATTGATAAGAAACACATATGATGGTTAAATTATTGAAAATATTGTTTAGAAAATTTA
TTTTATTAAATTAATTTGCTTTATTTAGCATTTTTACATTTTAATATAAATTATAATAAA
GGGTCCTTCAATGCGTGAAAATAATTTGAAATGTCAAACATGTAATTAAGAAATGTTGGA
ATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTCTACCAATATTCCATATAGGTTTTTT
TGGTGATGTCATTAACATCCTTTAATGTATTTGCAAGGTAAAAAGCATTTCTTACTTCTC
CTAATAGATTAAAAAGATAAATATATTTAATTACTCAATTCTTCTCCTAATTGATAATTT
AAAGTGTCTCTGAAATGACAAGAACTAATAAATGAATATTCTATTGATTGATTGATTTAT
TTATTTATTTAAATTTATTTTTACAATAAAAATAGAGTTGTGGTAAGGTTTTGCTGGATG
AAGATGAAAAGAAGAACTCAATGAAAAGAATGCAAAAAGCTATTGATGACAAAAATTATC
AATTAAGAGCTGATTTGTATGTAAAAATGAGAAAAGAATGCAAAAAAGGTGCCAACTAAA
AATGTAGGTCTTGTGGATATAAAAACGGACCCTTAAAGAAAATGCCTAAAATGCCTACAA
CTATTAGTTTTTCTGATCAAACCAAATTAGAATAGGATTTTCGTGACATTAGAGAATCTG
AAGACATATTTTAAGAGGTATTTATAAGACTTGTCTAGATTGACATTTTTAGTTTGTTAA
AGATGAATTTTTAGAAATTATTAAATTTGAAGATTTATTTATTTATTTATGGTTAATATT
TAATAAACTTATTTTATAAAATATGATAGAATTTAAGAAAAATTTTGGAAAGTAAAAATA
TGAAGGAAATGATTGAAATATTAAATCCTTTAGAAACCTATAAAATTTTCAGAAAAATTA
CATGTGATGAAATTTTATTATTTAATATTCAATAAAACCATCCTTGTGATTTAATTCTCA
CTCATATCATAGCACCCCCAGCTTGTATAAGACCAACTGTTAAAGAAGGAGAATCTAATG
TTCGTCACGATGATCTCACTGTTAAAATTAGAGATTTTTTGGACAGAAATAAAAGGTGAA
TTTAATAATCATTGTAATTGAAAAAATAAATTAAATATTATAAAAATTAAAGAATTGCTT
AGATGATAGAAGATGGTGAAGATTTAATTAAAATTAACTAAGAGTGGTTCTTACTTTAGT
GTTCACATGCTCACTATTTGAATGCTGAAACTCCAAACTTGCCTTTTAAAATGGACAAAG
ATTTTGGTAAAAAGGATATTAGAGCACTTGCACAAAGATTAAAAGGTAAAAAAGGTAGAT
TCAGAGGTAATCTTTCTGGTAAAAGATCAAACTTTACAGGTAGAACTGTTATTTCTCCTG
ACCCTAACATCCCTATTGATAATGTAAGATATCTTTAATATTATCTCATATAATTTTATA
AACCAAATAACAAAGGTTGTTGTTCCTGAATACATGGCTAAAATTCTCACTTTCCCTGAA
TAAGTTAATGCTATCAATATCGAAAGATTAAAAAAATTAGTTATAAATGGACCTGAAAAA
TATCCAGGAGCTCATTATATAATAGCAAAAGACACAGAAGACAAATTTAATCTATCAATA
GATAATAGAAGAAAGAAAGCAGATGAACTCAAGATTGGTGATATTGTAGAAAGACACATC
CAAAACGGAGAAATTTTACTTTTTAATAGACAGCCTTCTTTGCATAGAATTTCAATTATG
GCATTCAAGTGAGTTAACATTTTTTAATTTTAAACAATTGTTAAACTTGATTTATAAAAT
AGGGCCAATATATAAAAATGGAATACAATCAGATTTAATGAATGTTGCTGTGCTCCTTTC
AATGCTGATTTTGATGGTGATGAAATGAATATTCATGTTCCATAAACAATAGAAGCAAGA
GCTGAGGCCTAATATCTCCTTGATGTTAAACAAAATTTAATCAGTCCTAAAAATGGTGAG
GTAAATAAAAATTAAAACCATTGTGAAATAGATATAACCTGTCTATTGATTGCGAAATAA
AATGATATCATTTTAATAAAAAAATATAAATAAAATAAATTTAAGATTATTGAATTATTT
TATAAAGTGATTAATTTAAAAATTTTGTATATAAAAGTCAATTATTGCATTGATTTAGGA
TTTCTTAACTACTGCTTATTTAATCACTCATAAAGATATGTTTTTTGATAGAGCTGCTTT
TTGCTAATGCTGTACTTACTTCAGTGATGGTATTGAAAGAATTGATTTGCCTCCTCCAGC
TATCATACTTCCTGTTGGTATGAAATATTATTTATTAAATATATTTTAATCTTAAATTTA
TTAATAAAAAGAAATGTGGACTGGAAAATAAATTATAGATGTCATCCTAAGACCTAATAG
ATTTAGCAATATTATTGTTAATCTTATATTAAAAGAAAAATGCTACGATACTAAGTAAGA
TAGAGGTGTTATGTGTCCCACTGATGGTTATGTAGTCTTTCAATCATCTGAATTAATGTG
TGGTAATCTTGGTAAAACTACTTTAGGTTCTGGTAATAAAAATGGTTTGTTTTACAGATT
AAGTAGAGATAATTCTCAATACATGGCTGCATCAGTCATGAGTAGATTTGCAAAATTGTC
TGCTCGTTGGATTACAAATTATGGCATGACAATTGGTATTAGTGATGTTACTCCTTCTCC
AAGTCTCAACAAAATTAATGAAAAAAAGAAAGATGAAGCGTAAAAGAATTTTATTTATTT
ATTTAGCTTAAAATAAATTTTTTTAAAATATTTGTAAACAGCATCGATTCTTGTAAGTTC
CAAAGTCTTATTTTCACAAATTCTATTGGAAAACTAGATATGCAAACTGTTTCAGACAGA
AAAAAGCTTGTAGAAGCTGAAATTAGTAAAACTTTGAATCAAGTCAGAGAAGACATAGGT
TCAAATTGTAATAAGTAATTACCACCTACTAATGGTCCTCTTATTATGGCTACATGTGGT
TCAAAGGGTTCAGCAACCAACCTTTCTTAAATGATTGGATGTGTCGGTTAATAAATTATT
GGTGGTCGAAGAGTTCCTAATGGCTTTACTGGGCGTACTCTTCCTCATTTTGAAAAAGAT
GAAATATTCCCTCATCCAGAAGCTATGGGTTTCGTTAGAAATTCCTTCTTTACTGGTTTA
AGTGCACCAGAATTTTTCTTCCACACAATGGCTGGTCGTGAATCTCTTGTTGATACTGCT
GTCAAAACTGCAGATACAGGGTAAAAAAAATATGTTTATAAAAATAAAATTAATCATTTA
TTTTTTATAATACTTAGTTATATGAGTAGAAGATTGGTTAAGATGCTTGAAGATTTATCT
GTAAACTATGATCTTACAATTAGAACTTGTGATAAAAAAGAATTAGTTCAGTTTAGATAT
GGTGGTGATGGTATTTGTCCTTGGATGTCAGAAGAAAAAGTAACTGATAAAAGTATTCCA
ATAGATCTTGAAACTATGTTAAAATATGTCAAATCAATAGCTCCCATAAATTATAAGAGA
GAGTAATCCTTGTATCCTTATTAAATTTATCAAATCTGTTTGGAAGAATTAAAAAGAACA
AAAATGGATTATATTCCAGAATTAAGTTTAGAACCTATGTAAAACTCATCTTATAATAGA
GAATTCGACTAAGATTACATACAATAATAATTGAATAGTACAGATAACAAGTTTGATGTC
CAACTAGTATTTTATATTTTATAATCAAATAACTAAATTTAATCATATTTTCATTTAATC
CATAAGGTAAAAGAGCCCTTAGAGTACTTTAAAGACTCAGTAAGTCTATTTATCAAGTAG
ATATGCTAAAAAATTATGAAAGTGAGAACTTAACTTGGATTAACTCCTGGTGATATTGAG
TCACCTGATAATGCTACTAGCATCCATGTTGATAATACAATTCATATTACTAAAAGACAA
ATTAATTACTTCTTTAAAACTTTGTGGGAAAGATATCCATAGATGCTTGTTGAACCAGGA
GAGGCTGTAGGTGCAGTTGGTGCAACATCAATATCTGAACCAGCTACTTAAATGACTTTA
AAATCTTTTCAGTAACAATTTTTCCATTCAAAATACTTAAATATAAAAATTTCTAATATT
AAAAAATTTGACAATTGCTCAATTTCCTTAAAATTTATAAAACTTTTCTATCATTAAAAT
CGATTATTATTTTTTGAATTTAAAATCAAAAACAAATGATAAAAATAATATCATAAAAAT
TAAAAAAAATAAATATTATGTTTTTAAACAAAATAAATATTCAGACAATTAACAATTAGA
TAAATAGAAATACATATTTGATCACTAATAAAATTATTATCTAATTTGGTTTTAATTATT
AATGATTTAATTTTTGAATGGAAAGTAATCACAAAGCTTAAAAGATAAAATTTTCCAATA
AAATTACAAATTTAGAATAAAAATAAACTAAATAAAAATATGTATAAGTTTAAATAGTTT
TTGTATGAAAAAAAAAAAATTTCTGAAAAATCTTAAATTAATCAATTAATTTGTTGGTTA
TATTAAAGATGAATTAAAATTATTTTTAATAATTAATACTTATTTATGTAAATAAATGTT
ATATAAAATAGCTTTGCTGGTGTTGCGAGTATGAATATTACATAGGGTGTTCCAAGAATG
AAAGAAATCATTGATGCTGCTAAGAAAATTAGCACTCCAATCATAGATGTTAAGTTGCTT
CCTCAATTTTAGAGTGAGCACTCTTATAGATCAATTCGTTTACAAATAGAAAAAACTTAT
CTTGGTGAAATCAGTAACTTCTATCAAGAAGTTTACTCTCCTAAAGATTGCCACCTTTAC
ATAGAGTATAATAAGAAAAAATTGGAATAATTCAGACTTTATGGATTAGAAATACCTTTA
TCAAGCATTAAAAAAGGTAACTTTGCAATTGATATTTATAGGTTATTAATTTAAAATTTT
AATTTTAGGTATTCTTGAAATTGCTAAAGATATAAAGGAAGATTAAATTATTGCCGTAAA
GGATTAAGATCTCAAGCCTGTTGGTATTAAAATCAACCCAGGTAATGATGTCAAGAAGAA
CGTGTTCTTTAAAATTTAAAACTGGAAAAAGATACTTCCAGGAGCTGTTGTTTCAGGTAT
GAAGGATGTAAAGAGAGTAAGTATCTCAAAAGACAAGAAGAAGGGAGATAAAAATGAGTA
CAAATTCGATTTGTTTGTTGAAGGTAATTCTTTTAAATAAGTTTTACAACTTGATGAGGT
AGATTTTGCAAATACTCTTTCTGTTGATATTTTCGAAGTATTACAAATTTTGGGTGTAGA
AGCTGCAAGAAAGACAATTATAAATGAAATTACTAAAACTATCAAATCCCACTCTCTTAA
TGTCGATAGACGTCACTTGATTTTAGTTGCCGATGTCCTTACTTCTAAGGGTAATTTTTA
TTTTTTACAGAGTATATTTTTTTATTTTGAAATATAATCTTCATTTTAAAAAAGGTCGCT
TACATGGCTCAACCAGATAGGGAATCAATAGTATGAAAGACTCAACTTTGATGTTGGCTT
CATTCGAAAAAACTACTGAAATCTTATACAACGCTGCCTTATAGGGAAGAAAAGACACTT
TAGAAGGTGTATCTGAAAGAATTATTATTGGTCAAAATATTCCTATGGGAACAGGTACAT
TTAATTTGCTTTATGGAAACAGAAGTATTGTTCAGAAAAAGAAGAAGAAAATTATATCTT
CTAAAGTTAAATTTACTCCTCTTTTTAAAGATTCAAAATGA


>TTHERM_00037340(protein)
MQMSVIQPLRQLKETKRIGSIQYSILSTNEIIDMSEVCLDEPSFYNQTTRAPLNRGPLDL
RMGPSMRENNLKCQTCNQEMLECPGHFGFIKLALPIFHIGFFGDVINILQCICKSCGKVL
LDEDEKKNSMKRMQKAIDDKNYQLRADLYVKMRKECKKGANQKCRSCGYKNGPLKKMPKM
PTTISFSDQTKLEQDFRDIRESEDIFQENLRKILESKNMKEMIEILNPLETYKIFRKITC
DEILLFNIQQNHPCDLILTHIIAPPACIRPTVKEGESNVRHDDLTVKIRDFLDRNKRIAQ
MIEDGEDLIKINQEWFLLQCSHAHYLNAETPNLPFKMDKDFGKKDIRALAQRLKGKKGRF
RGNLSGKRSNFTGRTVISPDPNIPIDNVVVPEYMAKILTFPEQVNAINIERLKKLVINGP
EKYPGAHYIIAKDTEDKFNLSIDNRRKKADELKIGDIVERHIQNGEILLFNRQPSLHRIS
IMAFKANIQKWNTIRFNECCCAPFNADFDGDEMNIHVPQTIEARAEAQYLLDVKQNLISP
KNGESIIALIQDFLTTAYLITHKDMFFDRAAFCQCCTYFSDGIERIDLPPPAIILPVEMW
TGKQIIDVILRPNRFSNIIVNLILKEKCYDTKQDRGVMCPTDGYVVFQSSELMCGNLGKT
TLGSGNKNGLFYRLSRDNSQYMAASVMSRFAKLSARWITNYGMTIGISDVTPSPSLNKIN
EKKKDEAIDSCKFQSLIFTNSIGKLDMQTVSDRKKLVEAEISKTLNQVREDIGSNCNKQL
PPTNGPLIMATCGSKGSATNLSQMIGCVGQQIIGGRRVPNGFTGRTLPHFEKDEIFPHPE
AMGFVRNSFFTGLSAPEFFFHTMAGRESLVDTAVKTADTGYMSRRLVKMLEDLSVNYDLT
IRTCDKKELVQFRYGGDGICPWMSEEKVTDKSIPIDLETMLKYVKSIAPINYKREQSLYP
YQIYQICLEELKRTKMDYIPELSLEPMQNSSYNREFDQDYIQQQLNSTDNKFDVQLVKEP
LEYFKDSVSLFIKQICQKIMKVRTQLGLTPGDIESPDNATSIHVDNTIHITKRQINYFFK
TLWERYPQMLVEPGEAVGAVGATSISEPATQMTLKSFHFAGVASMNITQGVPRMKEIIDA
AKKISTPIIDVKLLPQFQSEHSYRSIRLQIEKTYLGEISNFYQEVYSPKDCHLYIEYNKK
KLEQFRLYGLEIPLSSIKKGILEIAKDIKEDQIIAVKDQDLKPVGIKINPGNDVKKNVFF
KIQNWKKILPGAVVSGMKDVKRVSISKDKKKGDKNEYKFDLFVEGNSFKQVLQLDEVDFA
NTLSVDIFEVLQILGVEAARKTIINEITKTIKSHSLNVDRRHLILVADVLTSKGRLHGST
RQGINSMKDSTLMLASFEKTTEILYNAALQGRKDTLEGVSERIIIGQNIPMGTGTFNLLY
GNRSIVQKKKKKIISSKVKFTPLFKDSK