Identifiers and Description

Gene Model Identifier

TTHERM_00037350

Standard Name

CTH13 (CaTHepsin 13)

Aliases

PreTt14470 | 2.m02406 | 3825.m02840

Description

CTH13 eukaryotic aspartyl protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00990.1 9.997093137033517e-262
Description: eukaryotic aspartyl protease (563 aa)
Oxytricha Contig18566.0.g98 3.999374135750469e-31
Description: Eukaryotic aspartyl protease
SGD YPL154C 6.999211576891585e-27
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
DictyBase DDB_G0279411 4.0013320766793207e-25
Description: ctsD on chromosome: 3 position 2104523 to 2105867
WormBase WBGene00000217 3.9989916100764785e-24
Description: locus:asp-4 status:Confirmed UniProt:Q21966 protein_id:CAA90633.1
Stentor Coeruleus SteCoe_10738 0.000000000005109089028063325
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037350(coding)
ATGATTGCAAATTAAAAAACTATTGCAGTGATATTTTTAATTGTTTTGAGCAATATATTT
GCAAGTTGCCAAAAAGATTAAGTAAAAATACACGAATTTAAAATATGTTAGAGCAGTAGT
AATTAGAGGTTGTTAAAAAGTGCTTCAGAGGAGAATAATGAAACCAAAGAGTTTAAAGAT
AGTGACAATTAAGAAAAGAAAGAAGGAAAAGGTTCTTAAATTCTTTTACCTCTTATTAAC
ATGTTGAATTTGCATTATGATACTGAGCTCTACTTTGGAAAGAACAAGCAACCCTTTAAA
TTAATTATAGATACAGGTTCCACTGCTTTGTGGATTCCAGATATTGATTGTATTAATTGC
AAACAGAATAACCTATGGAAGCTTTACAATTGCGACAAAAGTAGTACTTGTCATTCATAA
AATAAAGATGATATGATAAACATTGAATATGGAGTTGGGTCTGTAGATGGATATGTTGTG
AAAGAGAATATTTATTTAAGTGATAAAGATTAAACTGGATTCGAATACGAATTTCTATTA
GTAAAGAATGTCACTAACTTTAAGGTTTTACAAATATAAGGAATCATAGGTTTAGGCAGA
GAAGAAAGCAGTGAGTTTAATCATTAGACAATTTTAGGGAGCATGAAAAAAAAAGGTGTC
ATTGATTAAAGGGTATTCTCATTGTTTTTGAGTGACTCAAGTTGTTTAGGAAATAGTGTT
TTGGTCTTTGGAGGATATAATGAAGATTATACCTAAGGCCCTATTTCATATATTAGTGTA
AATACAAACGAAATGTGGAGTGTCGAAATATCATAAGCTGCTTTGGCTTTAAATACTCAA
AGCGATTCTAGTAATTAAAATGAAAAGAAAAAGTCGTTATTGTAATTCTCAACTGATACA
GTAATCATAGATAGTGGTACCACAAAAATCGTACTTCCAAAACCAGACTTAAGTGCATTA
ATGGATTTATTAAAATAAGATTTTGGAATTGTCTGCGAATTAGAGAAACGTTCTGCATCA
GCAGAAATATTTACTTTGGTTTGTGCAGAATCAGACTATTTAAAATATCCTTCCTTTATA
TTTACTTTGGGTTCAACTCCATCGGAATAAAAAGAATTTGAACTTACAGGGGAAGAATAT
ATTGAATCTTGCTTCTATCATTTGTAAGTTCGTAAGTGTGCTTTACGTTTCTAATATGTA
GAAACTGATTACATTTTGTTAGGTGATACATTCCTACGTAAATACTACACAATTTTTGAT
ATGGATAATCAAAGAATAGGCTTTGCCTTAGCCAAAGTTATCCAACCTAAACCATTCTAT
GAGACTCCCATTTTTAGTGCTTACTTAGGTTTAGGAATAACAATTGGCTTCCTCTTATTT
TTCTTGTTAATGTGTAAGATTCGCTCTATTTGGCAAGAGAGAAACTTTGAAAGGCTGCAT
TCAGTTAAAGCTCAAGCTGATTCTCCACCAAATACCACAGGTCCAGATGATCTTCATAGT
CATTAAAGACCAGGACACATAGAAATGTAACAAGGTAATGACTAAAGCATTGAAGATCCT
AATGACATTTCTGAAGAAATTTCTTAAGACGATATCTCTGATATTGACTAATCTTAAAAT
AAGAATTAATAATCATATAGATTACCTGTTCAGAAAAAAGAGTGA


>TTHERM_00037350(gene)
ATGATTGCAAATTAAAAAACTATTGCAGTGATATTTTTAATTGTTTTGAGCAATATATTT
GCAAGTTGCCAAAAAGATTAAGTAAAAATACACGAATTTAAAATATGTTAGAGCAGTAGT
AATTAGAGGTTGTTAAAAAGTGCTTCAGAGGAGAATAATGAAACCAAAGAGTTTAAAGAT
AGTGACAATTAAGAAAAGAAAGAAGGAAAAGGTTCTTAAATTCTTTTACCTCTTATTAAC
ATGTTGAATTTGCATTATGATACTGAGCTCTACTTTGGAAAGAACAAGCAACCCTTTAAA
TTAATTATAGATACAGGTTCCACTGCTTTGTGGATTCCAGATATTGATTGTATTAATTGC
AAACAGAATAACCTATGGAAGCTTTACAATTGCGACAAAAGTAGTACTTGTCATTCATAA
AATAAAGATGATATGATAAACATTGAATATGGAGTTGGGTCTGTAGATGGATATGTTGTG
AAAGAGAATATTTATTTAAGTGATAAAGATTAAACTGGATTCGAATACGAATTTCTATTA
GTAAAGAATGTCACTAACTTTAAGGTTTTACAAATATAAGGAATCATAGGTAATTATTTT
AACCAAATTCTTAATATTTAAATTTTAGAGAAAATATATTCAATTGAAATTTTCTAAACG
TTAGAAGGAGTTTCTTCTTTTAATTTTATAACACATACAAAAAAGCAAGCAATAAATCAA
TCAAACAATAAATAAATTATCAGATTTTCCGAAAAATTTCATAGATTTTTTTAATTTTTT
TTATAATGGACTCGAATTTTGAATTCTGATTAAATAACATTTTAGAAATTATGCTGAAAT
ACTTTTTTTCTCAATTTCTTTAAAGAAAAAAATGTTAGATCTAGGCAGCAAAATTTTCTC
TTCTTAGAAATACTTTGATTTATTTTATTTATCTAAACAGAATAAATAAATAAATTGATA
AAGAAATAATAAATTATCAAATATGGTTATTTTTATTATTAAATGGTTTTCAAGTATTTT
AATATAAAATAATCAAATATTGATCATAAAATTAAACAAATTATTTTTATTTATTCACTT
TATTAATATTTATATAATGAGTTGATTAGTTGTTTATTAAAATTTACTTTCTACTTTAGG
TTTAGGCAGAGAAGAAAGCAGTGAGTTTAATCATTAGACAATTTTAGGGAGCATGAAAAA
AAAAGGTGTCATTGATTAAAGGGTATTCTCATTGTTTTTGAGTGACTCAAGTTGTTTAGG
AAATAGTGTTTTGGTCTTTGGAGGATATAATGAAGATTATACCTAAGGCCCTATTTCATA
TATTAGTGTAAATACAAACGAAATGTGGAGTGTCGAAATATCATAAGCTGCTTTGGCTTT
AAATACTCAAAGCGATTCTAGTAATTAAAATGAAAAGAAAAAGTCGTTATTGTAATTCTC
AACTGATACAGTAATCATAGATAGTGGTACCACAAAAATCGTACTTCCAAAACCAGACTT
AAGTGCATTAATGGATTTATTAAAATAAGATTTTGGAATTGTCTGCGAATTAGAGAAACG
TTCTGCATCAGCAGAAATATTTACTTTGGTTTGTGCAGAATCAGACTATTTAAAATATCC
TTCCTTTATATTTACTTTGGGTTCAACTCCATCGGAATAAAAAGAATTTGAACTTACAGG
GGAAGAATATATTGAATCTTGCTTCTATCATTTGTAAGTTCGTAAGTGTGCTTTACGTTT
CTAATATGTAGAAACTGATTACATTTTGTTAGGTGATACATTCCTACGTAAATACTACAC
AATTTTTGATATGGATAATCAAAGAATAGGCTTTGCCTTAGCCAAAGTTATCCAACCTAA
ACCATTCTATGAGACTCCCATTTTTAGTGCTTACTTAGGTTTAGGAATAACAATTGGCTT
CCTCTTATTTTTCTTGTTAATGTGTAAGATTCGCTCTATTTGGCAAGAGAGAAACTTTGA
AAGGCTGCATTCAGTTAAAGCTCAAGCTGATTCTCCACCAAATACCACAGGTCCAGATGA
TCTTCATAGTCATTAAAGACCAGGACACATAGAAATGTAACAAGGTAATGACTAAAGCAT
TGAAGATCCTAATGACATTTCTGAAGAAATTTCTTAAGACGATATCTCTGATATTGACTA
ATCTTAAAATAAGAATTAATAATCATATAGATTACCTGTTCAGAAAAAAGAGTGA


>TTHERM_00037350(protein)
MIANQKTIAVIFLIVLSNIFASCQKDQVKIHEFKICQSSSNQRLLKSASEENNETKEFKD
SDNQEKKEGKGSQILLPLINMLNLHYDTELYFGKNKQPFKLIIDTGSTALWIPDIDCINC
KQNNLWKLYNCDKSSTCHSQNKDDMINIEYGVGSVDGYVVKENIYLSDKDQTGFEYEFLL
VKNVTNFKVLQIQGIIGLGREESSEFNHQTILGSMKKKGVIDQRVFSLFLSDSSCLGNSV
LVFGGYNEDYTQGPISYISVNTNEMWSVEISQAALALNTQSDSSNQNEKKKSLLQFSTDT
VIIDSGTTKIVLPKPDLSALMDLLKQDFGIVCELEKRSASAEIFTLVCAESDYLKYPSFI
FTLGSTPSEQKEFELTGEEYIESCFYHLQVRKCALRFQYVETDYILLGDTFLRKYYTIFD
MDNQRIGFALAKVIQPKPFYETPIFSAYLGLGITIGFLLFFLLMCKIRSIWQERNFERLH
SVKAQADSPPNTTGPDDLHSHQRPGHIEMQQGNDQSIEDPNDISEEISQDDISDIDQSQN
KNQQSYRLPVQKKE