Identifiers and Description

Gene Model Identifier

TTHERM_00043780

Standard Name

POLN1 (putative homolog to POLN)

Aliases

PreTt11055 | 3.m01785 | 3824.m02818

Description

POLN1 PolI-like DNA polymerase putative; DNA polymerase I family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01875.1 9.997093137033517e-262
Description: DNA polymerase I family protein (970 aa)
Oxytricha Contig21740.0.g8 9.997093137033517e-262
Description: DNA polymerase family A
DictyBase DDB_G0267464 1.0002534232488231e-144
Description: polA on chromosome: 1 position 1469084 to 1473264
WormBase WBGene00020964 9.004486704249587e-32
Description: locus:polq-1 status:Partially_confirmed UniProt:A0FLQ6 protein_id:CCD73325.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00043780(coding)
ATGATAACTTTCTTGAAGAGATTAACCAACAAAAATACATAAATCAATCAACCAGTTTTT
AGATTTTGTTCTGCTAACCCAAGCAACTCTCAAGTTTTAGGAGACTATGTAATCAAATCT
AAAATGAGTGGACACTCTTCTGAAAATTTATATGAGAAATATAAAAATTTTTACAATGTT
CAAATAGAAAAAATCAACATTCCTGGAACAACTATTGTAAAAAATAGAGACTAGGCTCAC
AAGGTTGTAAAAATCTTAAAAAGCTTACCAAACAGAGAGCATGCATGGGATACAGAAACT
ATAGATGTAGATGCTAAATTAGAATCTCCTATTGGAAAAGGAAAAATTATCTGCGCTTCA
GCCTTTTGTGGAATTGATGTAGATTTTGGAAATGGTCCAAGGTTGTTTATAGATAATTTT
GCTCAAAACACTGACTTGATTTAAATTTTTAAAGAGTATTTAGAAGATTCTAGATACAAA
AAGATTTGGCATAATTATGGATTTGATCGTCATATTTTTTATAATCATGGTATTAATGTC
TAAGGATTTGGAGGTGATACTATGCACTTGGCAAGATTAGCAGATCCAAGTAGAGGACCA
AAAGAATATAGTTTAGCAAATGTAACCAAGCATTATGAAGAAGAAATAAAATATTTAAAG
AGATAATTAATTAATGATCTGAGAAAAAGCATTTAAATTAATACATAAGAACTTCAAAGT
GTTTTAGCAGCACTTTAAAAAGGAGCAGATTTACCTCATGAAATTATTTAAAAATTCAAA
CTTCATAGATTTAATACAAGAGATGAATAAATATTCTTTATAAATGATCAAATACAAAAG
TGGTTGATCAAAAAATAGCCTGCTGATTAATATGAAAAATACTACTTAAATACAAACTTA
AAAACAAATATGAAACAACTCTTTGGTAAAAAGAAATACTTAAAAGATGGAAAAGAAGGA
AAAACTATTGAATTCCCAAATACTATTCGTATGCACACAGATCCAGAACTTCTAGAAAAA
TGGGTTCATTACTCATGTTTGGATGCTGAAATCACCTTCTTTGTTTTTTAAGTATTAAAA
GACGAATTAAAAAGTTTAAGCACCAACTTCGAAGACATGAAAAATATGTTAGATTTATAC
AACAAGTACTGGAAACCTTTTGGAGAAATATTAACTGATTTAGAAAGAAGAGGCTTTGAG
CTAAATTTGGAACATTTGGATAAAATTAGAGTTTAAGCTGAGAATGATATGATTAAATTG
GAAAAACAATTCTTAGATTGGGTATGCTCTACTCAATAAGGATTAGAATAATTTAATTAT
TCCTCTGCTCAGTAGCTTCAATAATTATTTTTTGCACCTTTCAAGAGAAAGAAAAGAATT
ACTAAGGATAAAGTCGATGCTAACTTGGATGATAAAGAAAAAAAAGATCTTGAAGGATTT
AAAAGTTTTGAAGAGAATAGTGCTGCTATTGATGATGACGAACAGTTTTTCAAATAATAA
TTTAATGAACAAAATGAAGATTTGGATGAAGACGAAGATGATGATGAGCCATAAAAAAAT
AAAAGGCTTTTCAAAAAAGCAAAGCCACAAGAAGATGATGACGATGGCTACCTTTCAGAT
GGTCGTAAGAAATCAGTCCGTAAAGAGGAAGATGATATCCCTTAGACAAAAGCCTTTAAA
GTCCTAAACATAAAGGGAATAATCCCAGAAGGAAAGAAAAAACCCCCAAAACAACTAGAT
ATGAATATCACAGGGCTCGGCCTAGAAGTAATTAGTCTTACTGACTCTGGAATGCCTGCA
GCCGATCTTCCAGTTTTAAAAATCTTAGCAGGAAACCCAAAAAAAGGAAATTATGGTGCA
ATAGGCGAATATTACAAACAAAAAGGAGATGAAGAAATGGGAAAAAGGGCTTCTCATGCT
ATTGAGTCTTTAATTTAACTTAAATAGGTAGAAACTCTTTTAACAACTTTTATTATTCCA
CTGAGAGAATTAGCAGATAAAGATGGAAGAATACACTGTTCACTGAATATGAATACTGAA
ACAGGAAGAATATCAGCAAGAAAACCTAATTTAATGAATTAACCCTCACATGATAAAGAT
GTGTATAAAATTCGTAGTGCTTTCTAAGCTGGTAAAGGTAACAAGCTTATTGTGGCTGAT
TATGGTCAATTAGAACTTAGAATTCTTGCTCATATGACAAATTGTAAGGCAATGATTGAA
GCCTTTAAAATGGGTGGTGATTTTCACAGTAGAACTGCTATGGGTATGTACCCTAAGCTA
AAGGAGGAAATAGAAAAGGGTGAGCTACTTTTAGAATGGGATAAATCTCAAGGAGAACCC
CCTGCACCGTTACTCAAAGATAAGTACTCAAGTGAAAGAAAAAAAGCTAAGATGATGAAT
TTCTCAATAGCATATGGAAAGAGTGCACATGGCTTTTCTAAAGATTGGAACTGCTCTATG
AAAGAAGCATAAGAAGCTCTAGATGCTTGGTTTGCAGACAGAAAGGAAGTAAAAGAATGG
CAAGAAAACACTAAAAAAATAGCCCTAGAACATGGATACACATAGACAATGATGGGAAGA
TATAGAAATTTAGAAAGGCTTACTCATTCAAAGAGTGCTAGACATCTTGTTTAACATGGT
TTAAGAGCCTCTATAAATACCCCAATTTAAGGTGGTGCAGCAGATTTAGTTATTGCTGCA
ATGGTAAAAGTATCATAAGACCCTAAGCTTAATGAGCTAGGCTACAAGCTATTGCTATAA
ATTCATGATGAATTAATCTTAGAAGGACCGGAAGAGCATGCTTAAGAAGCATTAGCAAGA
GTTATAGAAATAATGGAAAATCCCTTAGATACCCCATTATTGCTAAAGATGGAAGTAGAC
GCTAAAGTTGGTAATAATTGGTATGAGTGTAAATGA


>TTHERM_00043780(gene)
ATGATAACTTTCTTGAAGAGATTAACCAACAAAAATACATAAATCAATCAACCAGTTTTT
AGATTTTGTTCTGCTAACCCAAGCAACTCTCAAGTTTTAGGAGACTATGTAATCAAATCT
AAAATGAGTGGACACTCTTCTGAAAATTTATATGAGAAATATAAAAATTTTTACAATGTT
CAAATAGAAAAAATCAACATTCCTGGAACAACTATTGTAAAAAATAGAGACTAGGCTCAC
AAGGTTGTAAAAATCTTAAAAAGCTTACCAAACAGGTAAAATATGATCAAAATAATTTTT
AATTAAATGGTTAATTAATGATATAGAGAGCATGCATGGGATACAGAAACTATAGATGTA
GATGCTAAATTAGAATCTCCTATTGGAAAAGGAAAAATTATCTGCGCTTCAGCCTTTTGT
GGAATTGATGTAGATTTTGGAAATGGTCCAAGTATATTAAAAGAGTTTTTTTAGTTTAAC
AAAATTCAAAATAAATATAAATGATAACGTATTTATTTATTAATTCACTATATTTTATAA
CAATAGGGTTGTTTATAGATAATTTTGCTCAAAACACTGACTTGATTTAAATTTTTAAAG
AGTATTTAGAAGATTCTAGATACAAAAAGATTTGGCATAATTATGGATTTGATCGTCATA
TTTTTTATAATCATGGTATTAATGTCTAAGGATTTGGAGGTGATACTATGCACTTGGCAA
GATTAGCAGATCCAAGTAGAGGACCAAAAGAATATAGTTTAGCAAATGTAACCAAGCATT
ATGAAGAAGAAATAAAATATTTAAAGAGATAATTAATTAATGATCTGAGAAAAAGCATTT
AAATTAATACATAAGAACTTCAAAGTGTTTTAGCAGCACTTTAAAAAGGAGCAGATTTAC
CTCATGAAATTATTTAAAAATTCAAACTTCATAGATTTAATACAAGAGATGAATAAATAT
TCTTTATAAATGATCAAATACAAAAGTGGTTGATCAAAAAATAGCCTGCTGATTAATATG
AAAAATACTACTTAAATACAAACTTAAAAACAAATATGAAACAACTCTTTGGTAAAAAGA
AATACTTAAAAGATGGAAAAGAAGGAAAAACTATTGAATTCCCAAATACTATTCGTATGC
ACACAGATCCAGAACTTCTAGAAAAATGGGTTCATTACTCATGTTTGGATGCTGAAATCA
CCTTCTTTGTTTTTTAAGTATTAAAAGACGAATTAAAAAGTTTAAGCACCAACTTCGAAG
ACATGAAAAATATGTTAGATTTATACAACAAGTACTGGAAACCTTTTGGAGAAATATTAA
CTGATTTAGAAAGAAGAGGCTTTGAGCTAAATTTGGAACATTTGGATGTAACATATTCTT
TTAATTGATTATTTTTTTTAAAGTATTAAATATAGAAAATTAGAGTTTAAGCTGAGAATG
ATATGATTAAATTGGAAAAACAATTCTTAGATTGGGTATGCTCTACTCAATAAGGATTAG
AATAATTTAATTATTCCTCTGCTCAGTAGCTTCAATAATTATTTTTTGCACCTTTCAAGA
GAAAGAAAAGAATTACTAAGGATAAAGTCGATGCTAACTTGGATGATAAAGAAAAAAAAG
ATCTTGAAGGATTTAAAAGTTTTGAAGAGAATAGTGCTGCTATTGATGATGACGAACAGT
TTTTCAAATAATAATTTAATGAACAAAATGAAGATTTGGATGAAGACGAAGATGATGATG
AGCCATAAAAAAATAAAAGGCTTTTCAAAAAAGCAAAGCCACAAGAAGATGATGACGATG
GCTACCTTTCAGATGGTCGTAAGAAATCAGTCCGTAAAGAGGAAGATGATATCCCTTAGA
CAAAAGCCTTTAAAGTCCTAAACATAAAGGTATTAAAATATATATTTACTTCTTAAATAA
TTTATATTTAAACTGTATATTTTTAAATACAGGGAATAATCCCAGAAGGAAAGAAAAAAC
CCCCAAAACAACTAGATATGAATATCACAGGGCTCGGCCTAGAAGTAATTAGTCTTACTG
ACTCTGGAATGCCTGCAGCCGATCTTCCAGTTTTAAAAATCTTAGCAGGAAACCCAAAAA
AAGGAAATTATGGTGCAATAGGTAAATTGTTGAAAAATAATTAATTAGCAGCTAAAGTAT
ACAATTAAATAGGCGAATATTACAAACAAAAAGGAGATGAAGAAATGGGAAAAAGGGCTT
CTCATGCTATTGAGTCTTTAATTTAACTTAAATAGGTAGAAACTCTTTTAACAACTTTTA
TTATTCCACTGAGAGAATTAGCAGATAAAGATGGAAGAATACACTGTTCACTGAATATGA
ATACTGAAACAGGAAGAATATCAGCAAGAAAACCTAATTTAATGAATTAACCCTCACATG
ATAAAGATGTGTATAAAATTCGTAGTGCTTTCTAAGCTGGTAAAGGTAACAAGCTTATTG
TGGCTGATTATGGTCAATTAGAACTTAGAATTCTTGCTCATATGACAAATTGTAAGGCAA
TGATTGAAGCCTTTAAAATGGGTAAAATTTTATCTTGTAAAAACAAAAGATAAAAAATTT
TTTTTTATTAAATAGGTGGTGATTTTCACAGTAGAACTGCTATGGGTATGTACCCTAAGC
TAAAGGAGGAAATAGAAAAGGGTGAGCTACTTTTAGAATGGGATAAATCTCAAGGAGAAC
CCCCTGCACCGTTACTCAAAGATAAGTACTCAAGTGAAAGAAAAAAAGCTAAGATGATGA
ATTTCTCAATAGCATATGGAAAGAGTGCACATGGCTTTTCTAAAGATTGGAACTGCTCTA
TGAAAGAAGCATAAGAAGCTCTAGATGCTTGGTTTGCAGACAGAAAGGAAGTAAAAGAAT
GGCAAGAAAACACTAAAAAAATAGCCCTAGAACATGGATACACATAGACAATGATGGGAA
GATATAGAAATTTAGAAAGGCTTACTCATTCAAAGAGTGCTAGACATCTTGTTTAACATG
GTTTAAGAGCCTCTATAAATACCCCAATTTAAGGTGGTGCAGCAGATTTAGTTATTGCTG
CAATGGTAAAAGTATCATAAGACCCTAAGCTTAATGAGCTAGGCTACAAGCTATTGCTAT
AAATTCATGATGAATTAATCTTAGTATTTTAAAAAAATTTATTTATCATTTAATTTTAAC
TAATGATAATAAAATAGGAAGGACCGGAAGAGCATGCTTAAGAAGCATTAGCAAGAGTTA
TAGAAATAATGGAAAATCCCTTAGATACCCCATTATTGCTAAAGATGGAAGTAGACGCTA
AAGTTGGTAATAATTGGTATGAGTGTAAATGA


>TTHERM_00043780(protein)
MITFLKRLTNKNTQINQPVFRFCSANPSNSQVLGDYVIKSKMSGHSSENLYEKYKNFYNV
QIEKINIPGTTIVKNRDQAHKVVKILKSLPNREHAWDTETIDVDAKLESPIGKGKIICAS
AFCGIDVDFGNGPRLFIDNFAQNTDLIQIFKEYLEDSRYKKIWHNYGFDRHIFYNHGINV
QGFGGDTMHLARLADPSRGPKEYSLANVTKHYEEEIKYLKRQLINDLRKSIQINTQELQS
VLAALQKGADLPHEIIQKFKLHRFNTRDEQIFFINDQIQKWLIKKQPADQYEKYYLNTNL
KTNMKQLFGKKKYLKDGKEGKTIEFPNTIRMHTDPELLEKWVHYSCLDAEITFFVFQVLK
DELKSLSTNFEDMKNMLDLYNKYWKPFGEILTDLERRGFELNLEHLDKIRVQAENDMIKL
EKQFLDWVCSTQQGLEQFNYSSAQQLQQLFFAPFKRKKRITKDKVDANLDDKEKKDLEGF
KSFEENSAAIDDDEQFFKQQFNEQNEDLDEDEDDDEPQKNKRLFKKAKPQEDDDDGYLSD
GRKKSVRKEEDDIPQTKAFKVLNIKGIIPEGKKKPPKQLDMNITGLGLEVISLTDSGMPA
ADLPVLKILAGNPKKGNYGAIGEYYKQKGDEEMGKRASHAIESLIQLKQVETLLTTFIIP
LRELADKDGRIHCSLNMNTETGRISARKPNLMNQPSHDKDVYKIRSAFQAGKGNKLIVAD
YGQLELRILAHMTNCKAMIEAFKMGGDFHSRTAMGMYPKLKEEIEKGELLLEWDKSQGEP
PAPLLKDKYSSERKKAKMMNFSIAYGKSAHGFSKDWNCSMKEAQEALDAWFADRKEVKEW
QENTKKIALEHGYTQTMMGRYRNLERLTHSKSARHLVQHGLRASINTPIQGGAADLVIAA
MVKVSQDPKLNELGYKLLLQIHDELILEGPEEHAQEALARVIEIMENPLDTPLLLKMEVD
AKVGNNWYECK