Identifiers and Description

Gene Model Identifier

TTHERM_000446029

Standard Name

BrEt-3 (Bromodomain and ET domain 3)

Aliases

None

Description

bromodomain domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10847.1 9.997093137033517e-262
Description: hypothetical protein (677 aa)
Oxytricha Contig18994.0.g68 2.0004286606204839e-16
Description: Bromodomain
SGD YGR252W 4.999617891954556e-16
Description: GCN5 Acetyltransferase, modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; catalytic subunit of the ADA and SAGA histone acetyltransferase complexes; founding member of the Gcn5p-related N-acetyltransferase superfamily; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay
Stentor Coeruleus SteCoe_26840 0.000000000000001713908431542013
Description: None
DictyBase DDB_G0293800 0.00000000000001000191320216021
Description: DDB_G0293800 on chromosome: 6 position 3334534 to 3337072
WormBase WBGene00017423 0.000000000000020000882446601127
Description: status:Confirmed UniProt:O76561 protein_id:CCD69431.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_000446029(coding)
ATGATGATAAATACTCAGAACAACACCACTGTTGAGTTCTTCTTATCTTCAGAGTAATAA
AGAATCATAAATGAATTGCTCCCAAAGGGATACTCTCTCTAGTTCGCTTCCAAGCCAGCC
AGATCTAAATCAGGCAGCTTTACCAAAACTATTGCTTAATTTGGTCGTTAAAATGATGGA
TAATTAAGAAACTCAAACGGCTAATTCGCTCCTTCCTCTAAAGCTTCTAAAAAATATGGA
ACAGGAAAGTTAGCATCATAGGAAGGATATGCTGTCCCTTCGTTAAGCTACTAAGGAATT
AATTAAGCAGCTTATCCTCCTATGCAAGGAAACGGATCAAATTAAAATAACAATGGAATG
AATACTCCTCAATTAAATAGTTAATCTTCTTAAATTTAGGGCTAATATAACTAAATCCCT
AACTTGAATTAAAGCTAATCTCAAGTCAACTAATAATCTGGTTTAAATCAGCAATACTCT
CAAAACAATAATTAACTTGGATATTAACAGTAATAGCAAATTTAGCAATAAGCATAAATG
AATTAAGGAGTATAGATGAACAATATGCAAATGTAGTAGTAATAAATGAACTAAGGAGGA
GCCATGTATGGTCAAAACCAAAATAATGACTATTATCAAATGCAATAATAGAATTCCTCT
TAGTATTAAACTTCAGATCAAATTCGTATGAATTAATAAATGTAATAACCAGATATTTAC
AACTAACACTTAATCCACATGAAGCCTACTGGTTAACGTAAGAACACTGTCAGCAAACCT
CGCAAAGAAAAAAAACTCAAGCAAAATGAAAAAGCTCAAAAATTAAATAAAAGAAAGAGC
GATGCAAGTCTTGCTGCTAAAGTCTCAAAGAAGTAAAGAGCTCTTATGGCTGCTGTTGGA
AATGAAGAAATCAGCTATGGAGGTATGCATCCTGTAGAATAAAAGAAGTGCTTACACATT
CTACACTCTCTACAAAAGCACAAATCTTCAAAGCCTTTCTTGAAACCAGTTGACCCAATA
AAAGAAGGATGTCCTGATTATTACATGGTTATCCGCGAACCAATGGATTTATCTACTGTT
GAAAAAAATCTGAAAGCTCATCTATACTAATCCCCAACATAATTTGCTGCTGATATCCAC
AAGATTTGGAAAAATAGCTTTATTTACAACAATCGTGACTCTTAAATATATAACATGACT
CTTGAAATGGAAAAATATTTCAGCAGAAAGTTCAAAGAAATTGAAACTAACTTGTATACC
AAGACTGATGGAAGAACTTCTACAACTGACATCATTTAGGCATTAACAGGCTTCTTAACC
TAGAACTAAAAAGGTACAAAGAAAAACAAAATAGCTGGTCTTTAACCTATCCAAGTCCCC
CTAACATCAGCTCCTTAACCCACCAAAAAGACTAAAAATCCTACCTCAAAAATGGATATT
CCCATGACAATGTAAGAAAAAAAGAATCTCGGACAAAACATTTTATTACTCCCACCTGAA
TGTTTACGTGGAGTTTGGGAGATTGTATAATCTGATGGAAACTAGCAGTATGACGACAAA
ATACTCACCTTTGACATTGATGCTCTATCAGTTCGTAAAACTCGTGAATTAGAATAGTAT
GTCAAGCAAAACATGGCTGCCAACAACAAAAGACTCTCCAAGAAGTAAGCAAAAATCCAA
GAAAAGTCCATGAATGCTGACTAAAAGCTTATCTAAAATTCAACATTCGGTTAAGATGAC
GAAACTGCAGCTACTCATCATGAAACAGTTATTGTTTAAGATATGACTTAGAGCACAATT
CAGCACACACAATAGTATCAAGTTCCTATGCACCCAAGCTAATATCAAATGGAGCAAATG
CACACCTAAACCATTGGATCTTATGGAAATGGATAGACAGAGTATGCCTAACATCAACAT
GATATGAATTAGGGAATGGATGAATAAGGAGATATCAACGATATAGATTCAGACTCATCT
AACATTAGTGACAATGACAGTGACAGTCAATTCAATTGA


>TTHERM_000446029(gene)
ATGGATAACTTAAATAGTAACCAGGTATTTAATTAAAATTAAAATTATTTCTCCTCTTTT
ATTTTCTCTTTCTTTTCATATTTATATTTATTCGCTCAAGCTTTTCATATAATCCAAACA
TATTGTTTATAGTAAGTTAATTAGTTAGTAGTTAGTTAGTTAGTTAGTTAGTAAAAAAGC
AAATAAGTAAAAAAGTTAGAAAAAATAAATAAATAAGTTAGTGGTTAGTTAGCAAATAAG
TAAGCGAATGAGCTATTTCCACCTACGCATCCAACATCTAACAATATACTTTCATACTAA
TAGTTTTATTGTTTATCATTAAGTTAGTAGTAGCTCCTCTCAAACTATAAATCCATCTCA
AATTCCTACACTTCAAATTGTCTTTAAAAATTTTTAATAAATATAAAGCTCTCTTTAATA
ATTATTTTATCTTAAAATATTTCAATTTCAATTGCGTAAAATAGTTATTTACATTCAAAG
GCTTCCATTTATGCATGTAATCAAATCGTTGGTCTTTCTCTAAATTGTCTTTTATATGAA
TGAGAGTTCATTCATAAGTAGTTTAGGTTGATATATATCTTGTCTTTAGTAAGATTCTAC
TTAACGCTAAGCTATATCGAAGTAGTTGCACATTTTCAAGCAGCAAGCAAGCATGTAGAA
TTAAATAGACACTAAAATTATTTAGATAGTTATATATATTATAAAGCATTCAAAAAACAA
GAAGCTCACTTTTTCTAAGAAGTCCTTCAAAGATTCTAAAGATGATATTCAAATTATAAT
AAATTAGGTTAAAATTAAAGTTGTGTAGGATATGATGGTAGTTATGCTGAGAGAGAGTTT
TTTATGAAAATTCTATGGTTTTCTTTTTTAAAAATGCGAAATTATTTAAATTAGAATTAA
AATAGCTAAGCTAATTAACTAATTAACAAACTAACTAAGTAACGCGATTTTGAGTTTTCT
ACATAGAGTTAATTTTTTTTTTGCAAAAGTGCAAAAATTTTTGGGAGCGAAAATATAAAT
GATAAGAAGAAAAAAAAAGAAAGATATTTTAAAAAAGAAAACATTTTTTGAAATTTCATA
ATAAAAATATTTTAAAATAAAAACAGATAAATACTCAGAACAACACCACTGTTGAGTTCT
TCTTATCTTCAGAGTAATAAAGAATCATAAATGAATTGCTCCCAAAGGGATACTCTCTCT
AGTTCGCTTCCAAGCCAGCCAGATCTAAATCAGGCAGCTTTACCAAAACTATTGCTTAAT
TTGGTCGTTAAAATGTAATCATTTTTTTAAAATACGATTGTCTATTTTAATAATTTTTTT
CGAAATGACTTTGAATTTTTTAAATTCATTTTTATGCATACAAAAAATAAATATATTTAT
ATTTAAATATAGGATGGATAATTAAGAAACTCAAACGGCTAATTCGCTCCTTCCTCTAAA
GCTTCTAAAAAATATGGAACAGGAAAGTTAGCATCATAGGAAGGATATGCTGTCCCTTCG
TTAAGCTACTAAGGAATTAATTAAGCAGCTTATCCTCCTATGCAAGGAAACGGATCAAAT
TAAAATAACAATGGAATGAATACTCCTCAATTAAATAGTTAATCTTCTTAAATTTAGGGC
TAATATAACTAAATCCCTAACTTGAATTAAAGCTAATCTCAAGTCAACTAATAATCTGGT
TTAAATCAGCAATACTCTCAAAACAATAATTAACTTGGATATTAACAGTAATAGCAAATT
TAGCAATAAGCATAAATGAATTAAGGAGTATAGATGAACAATATGCAAATGTAGTAGTAA
TAAATGAACTAAGGAGGAGCCATGTATGGTCAAAACCAAAATAATGACTATTATCAAATG
CAATAATAGAATTCCTCTTAGTATTAAACTTCAGATCAAATTCGTATGAATTAATAAATG
TAATAACCAGATATTTACAACTAACACTTAATCCACATGAAGCCTACTGGTTAACGTAAG
AACACTGTCAGCAAACCTCGCAAAGAAAAAAAACTCAAGCAAAATGAAAAAGCTCAAAAA
TTAAATAAAAGAAAGAGCGATGCAAGTCTTGCTGCTAAAGTCTCAAAGAAGTAAAGAGCT
CTTATGGCTGCTGTTGGAAATGAAGAAATCAGCTATGGAGGTATGCATCCTGTAGAATAA
AAGAAGTGCTTACACATTCTACACTCTCTACAAAAGCACAAATCTTCAAAGCCTTTCTTG
AAACCAGTTGACCCAATAAAAGAAGGATGTCCTGATTATTACATGGTTATCCGCGAACCA
ATGGATTTATCTACTGTTGAAAAAAATCTGAAAGCTCATCTATACTAATCCCCAACATAA
TTTGCTGCTGATATCCACAAGATTTGGAAAAATAGCTTTATTTACAACAATCGTGACTCT
TAAATATATAACATGACTCTTGAAATGGAAAAATATTTCAGCAGAAAGTTCAAAGAAATT
GAAACTAACTTGTATACCAAGACTGATGGAAGAACTTCTACAACTGACATCATTTAGGCA
TTAACAGGCTTCTTAACCTAGAACTAAAAAGGTACAAAGAAAAACAAAATAGCTGGTCTT
TAACCTATCCAAGTCCCCCTAACATCAGCTCCTTAACCCACCAAAAAGACTAAAAATCCT
ACCTCAAAAATGGATATTCCCATGACAATGTAAGAAAAAAAGAATCTCGGACAAAACATT
TTATTACTCCCACCTGAATGTTTACGTGGAGTTTGGGAGATTGTATAATCTGATGGAAAC
TAGCAGTATGACGACAAAATACTCACCTTTGACATTGATGCTCTATCAGTTCGTAAAACT
CGTGAATTAGAATAGTATGTCAAGCAAAACATGGCTGCCAACAACAAAAGACTCTCCAAG
AAGTAAGCAAAAATCCAAGAAAAGTCCATGAATGCTGACTAAAAGCTTATCTAAAATTCA
ACATTCGGTTAAGATGACGAAACTGCAGCTACTCATCATGAAACAGTTATTGTTTAAGGT
AATTTTCCCTTTTTAGAATTTCATTTTCAAAAAAATTATTTATAAAGAATTTTCTTTAAA
AATAAACATTTTAATTTAATTTCACAAACTAAAGATTTTCAATATTTTAATTAAATTTCG
TTTGATATGCTATATTAATATTAGACTATAACTATACAGATATGACTTAGAGCACAATTC
AGCACACACAATAGTATCAAGTTCCTATGCACCCAAGCTAATATCAAATGGAGCAAATGC
ACACCTAAACCATTGGATCTTATGGAAATGGATAGACAGAGTATGCCTAACATCAACATG
ATATGAATTAGGGAATGGATGAATAAGGAGATATCAACGATATAGATTCAGACTCATCTA
ACATTAGTGACAGTAATTTCAATTAATTAAACTATTATTTGGTTTATATAAATTGTATTT
AACTCAAAAATCTAAACTAAAATTTTTATTAAATAGATGACAGTGACAGTCAATTCAATT
GA


>TTHERM_000446029(protein)
MMINTQNNTTVEFFLSSEQQRIINELLPKGYSLQFASKPARSKSGSFTKTIAQFGRQNDG
QLRNSNGQFAPSSKASKKYGTGKLASQEGYAVPSLSYQGINQAAYPPMQGNGSNQNNNGM
NTPQLNSQSSQIQGQYNQIPNLNQSQSQVNQQSGLNQQYSQNNNQLGYQQQQQIQQQAQM
NQGVQMNNMQMQQQQMNQGGAMYGQNQNNDYYQMQQQNSSQYQTSDQIRMNQQMQQPDIY
NQHLIHMKPTGQRKNTVSKPRKEKKLKQNEKAQKLNKRKSDASLAAKVSKKQRALMAAVG
NEEISYGGMHPVEQKKCLHILHSLQKHKSSKPFLKPVDPIKEGCPDYYMVIREPMDLSTV
EKNLKAHLYQSPTQFAADIHKIWKNSFIYNNRDSQIYNMTLEMEKYFSRKFKEIETNLYT
KTDGRTSTTDIIQALTGFLTQNQKGTKKNKIAGLQPIQVPLTSAPQPTKKTKNPTSKMDI
PMTMQEKKNLGQNILLLPPECLRGVWEIVQSDGNQQYDDKILTFDIDALSVRKTRELEQY
VKQNMAANNKRLSKKQAKIQEKSMNADQKLIQNSTFGQDDETAATHHETVIVQDMTQSTI
QHTQQYQVPMHPSQYQMEQMHTQTIGSYGNGQTEYAQHQHDMNQGMDEQGDINDIDSDSS
NISDNDSDSQFN