Identifiers and Description

Gene Model Identifier

TTHERM_00046480

Standard Name

ENO2 (ENOlase 2)

Aliases

PreTt11127 | 3.m01762 | 3824.m02888

Description

ENO2 phosphopyruvate hydratase; Enolase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_31088 0
Description: None
WormBase WBGene00011884 9.997093137033517e-262
Description: locus:enol-1 Enolase status:Confirmed UniProt:Q27527 protein_id:CAA92692.1
Tetrahymena borealis EI9_01799.1 9.997093137033517e-262
Description: enolase (465 aa)
DictyBase DDB_G0283137 9.997093137033517e-262
Description: enoA on chromosome: 4 position 225309 to 226956
Oxytricha Contig15891.0.g72 9.997093137033517e-262
Description: Enolase, C-terminal TIM barrel domain
SGD YGR254W 9.997093137033517e-262
Description: ENO1 Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046480(coding)
ATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAGCCTACCTTCGGCTTCTCATCT
ATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGAGGTAATCCCACTATTGAAGCT
GAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTTCCTTCTGGTGCTTCCACTGGT
ATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAGAGATACTTAGGTAAGGGTGTT
TAAAAGGCTGTCAACAATGTCAACAACGTTATTGCTCCTGCTTTGAAGGGCAAGAACCCC
GCTGAATAAGAAAAGTTGGACAGATTCATGGTCGAAAGCTTAGATGGTAGCAAGAACTAA
TATGGCTGGTGCAAGAGCAACTTAGGTGCTAATGCTATTTTGGGTGTCTCCCTTGCCTTA
GCCAGAGCTGGTGCTGCTGAAAAGAACATTCCTCTTTATCAATACTTAGGTCAATTGGCT
GGTAAGAAATAAAACAAATACATCTTACCCGTACCCTCCCTCAACGTTATTAACGGTGGT
AAGCACGCTGGTAACAAGCTTGCTATGCAAGAATTCATGATCTTGCCCACTGGTGCCACC
AGCTTCAAGGAATCTATGTAAATTGGTTGTGAAGTCTACCACTCCCTTAAGAGTGTCATC
AAGAAAAAATACGGTCTTGATGCTACCAACGTTGGTGATGAAGGTGGTTTCGCTCCTAAC
ATTCTCTAAACCAGAGACGGTCTTAACCTCCTCTTAGAAGCCATCGAAAAGGCTGGCCAC
AAGGGTAAGGTTGACATTGGTATGGATGTTGCTGCCTCTGAATTCTGGGTACCTGAAAAG
AAGGTTTATGACTTAGATTTCAAGACTGCCAACAACGACGGATCTAACTAACTCACTGGT
GAAGCTTTAACCAACCTCTACTAATAATTAGTTAAGGAATACGGTATTGTCTCTATTGAA
GATCCTTTCGACCAAGATGACTGGGCTGCTTATGCTAACATGAATGCCTTAGTTGGTAAG
ACCACTCAAATTGTTGGTGATGATTTACTCGTTACTAATCCTACCAGAGTTAAATAAGCT
ATCTAATCAAAGGCTTGCAACGCCCTTCTTTTGAAGGTCAACTAAATCGGTTCAGTTACT
GAATCTATTGAAGCTTCAGTTCTTTCTTAAAATGCTGGTTTTGGTGTTATGGTTTCTCAC
AGATCAGGTGAAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTTTGGCTACTGGT
CAAATTAAGACTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACAACCAACTCTTA
AGAATCGAATAAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCTTCAGAAACCCC
TCTAACCTCCTTTGA


>TTHERM_00046480(gene)
ATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAGCCTACCTTCGGCTTCTCATCT
ATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGAGGTAATCCCACTATTGAAGCT
GAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTTCCTTCTGGTGCTTCCACTGGT
ATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAGAGGTAAATATTGAATACATTT
ATAAAAAAAACTACAATTTCAATAAAGCTTGTTTCATCAAATTTTATACTTTGCAAATCC
AGAATCTTCAATTTTTTTTTGACTTCTTTCTACTTGGTTCTTGGGAATTAATTTTAAATA
TGTATAAGAAATTTCTACCTACTTGGCCTACTTTTTTCATAGTAGAATTGAATAAAAGAA
TCAAACACTTAGAAGATATATTTTAAAAAGATTAAACTTACATCATTATTTAAAAGATAC
TTAGGTAAGGGTGTTTAAAAGGCTGTCAACAATGTCAACAACGTTATTGCTCCTGCTTTG
AAGGGCAAGAACCCCGCTGAATAAGAAAAGTTGGACAGATTCATGGTCGAAAGCTTAGAT
GGTAGCAAGAACTAATATGGCTGGTGCAAGAGCAACTTAGGTGCTAATGCTATTTTGGGT
GTCTCCCTTGCCTTAGCCAGAGCTGGTGCTGCTGAAAAGAACATTCCTCTTTATCAATAC
TTAGGTCAATTGGCTGGTAAGAAATAAAACAAATACATCTTACCCGTACCCTCCCTCAAC
GTTATTAACGGTGGTAAGCACGCTGGTAACAAGCTTGCTATGCAAGAATTCATGATCTTG
CCCACTGGTGCCACCAGCTTCAAGGAATCTATGTAAATTGGTTGTGAAGTCTACCACTCC
CTTAAGAGTGTCATCAAGAAAAAATACGGTCTTGATGCTACCAACGTTGGTGATGAAGGT
GGTTTCGCTCCTAACATTCTCTAAACCAGAGACGGTCTTAACCTCCTCTTAGAAGCCATC
GAAAAGGCTGGTAAGAAATAAATTCTTTACCTTTACTTAACTCTTTAACTACATAAAAAT
AAATAAGAAGGCTTAGCTATTTTTCAACCCTAAATTGCGTATTTTTAATAATAGTAGTAA
AATGAAGTAAGAAATGAATAAATTTGCTTGAAATATCAAAGAAATAGCTTGAAAATTTTC
AAGAAATTATATTAAAAGCAAATAATTCTTATTAAATAAAAGTATAAGATATTTGAATAA
TAAATCGTCATTGTTGGTAGATATAACTAATAGCTAAGCTATATTTAAAATTAAATCGCA
ATTCTAAAATTTAATTAAGTTTCTATTAACGTATTAATAATCTATCTTTACAAAAAAATT
AATAAGGATTCATTCCAAAGAAACTTCTTATTAATTTCCAAATTTTACATAAAAACAGTA
AAAAAATAAAGTATAACCATAAAGAGTTTCTGCAATTTTTATAAATGAAATGCTAAATTA
TATTTATTAAAATATTTAGGCCACAAGGGTAAGGTTGACATTGGTATGGATGTTGCTGCC
TCTGAATTCTGGGTACCTGAAAAGAAGGTTTATGACTTAGATTTCAAGACTGCCAACAAC
GACGGATCTAACTAACTCACTGGTGAAGCTTTAACCAACCTCTACTAATAATTAGTTAAG
GAATACGGTATTGTCTCTATTGAAGATCCTTTCGACCAAGATGACTGGGCTGCTTATGCT
AACATGAATGCCTTAGTTGGTAAGACCACTCAAATTGTTGGTGATGATTTACTCGTTACT
AATCCTACCAGAGTTAAATAAGCTATCTAATCAAAGGCTTGCAACGCCCTTCTTTTGAAG
GTCAACTAAATCGGTTCAGTTACTGAATCTATTGAAGCTTCAGTTCTTTCTTAAGTAATT
AGCTTTTTTTTTTAACTCTTCAAATTAAAAATTTTGTATAAAAAAATAAAATTTACTTAT
TTCAATTTCTAAAAATAAAGAATGCTGGTTTTGGTGTTATGGTTTCTCACAGATCAGGTG
AAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTTTGGCTACTGGTCAAATTAAGA
CTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACAACCAACTCTTAAGAATCGAAT
AAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCTTCAGAAACCCCTCTAACCTCC
TTTGA


>TTHERM_00046480(protein)
MLSKLTKNLYMNKPTFGFSSIQNVFAREILDSRGNPTIEAEVVTSKGAFRAAVPSGASTG
IYEALELRDGDKKRYLGKGVQKAVNNVNNVIAPALKGKNPAEQEKLDRFMVESLDGSKNQ
YGWCKSNLGANAILGVSLALARAGAAEKNIPLYQYLGQLAGKKQNKYILPVPSLNVINGG
KHAGNKLAMQEFMILPTGATSFKESMQIGCEVYHSLKSVIKKKYGLDATNVGDEGGFAPN
ILQTRDGLNLLLEAIEKAGHKGKVDIGMDVAASEFWVPEKKVYDLDFKTANNDGSNQLTG
EALTNLYQQLVKEYGIVSIEDPFDQDDWAAYANMNALVGKTTQIVGDDLLVTNPTRVKQA
IQSKACNALLLKVNQIGSVTESIEASVLSQNAGFGVMVSHRSGETEDTFIADLVVGLATG
QIKTGAPCRSERLAKYNQLLRIEQEVGSKAVFAGKSFRNPSNLL