Identifiers and Description

Gene Model Identifier

TTHERM_00046760

Standard Name

HAT1 (Histone AcetylTransferase 1)

Aliases

PreTt11155 | 3.m01941 | 3824.m02916 | KAT1

Description

HAT1 histone acetyl transferase HAT1 amine-terminal protein; Histone acetyltransferase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01775.1 9.997093137033517e-262
Description: hypothetical protein (472 aa)
Oxytricha Contig10852.0.g20 3.00033207980219e-32
Description: Histone acetyl transferase HAT1 N-terminus
DictyBase DDB_G0275159 9.995528898049344e-31
Description: DDB_G0275159 on chromosome: 2 position 5204831 to 5206231
WormBase WBGene00044069 2.9993110246221282e-28
Description: locus:hat-1 status:Confirmed UniProt:Q21484 protein_id:CAA88954.2
SGD YPL001W 6.001122775063233e-17
Description: HAT1 Catalytic subunit of the Hat1p-Hat2p histone acetyltransferase complex that uses the cofactor acetyl coenzyme A, to acetylate free nuclear and cytoplasmic histone H4; involved in telomeric silencing and DNA double-strand break repair

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00046760(coding)
ATGTCTGATAAGAAAAACCAAAAAATTGACCTCTCTTAGTTTGAGGGTCCAGATGGAATG
CAAAAGCTAATGAAATTAGCTATGGAGTTCCAAGAAAATGAAAAATAACAAAAAGGATAA
AAAAAGAATAAAAAAAAAGTAGATTAAGACTTAGGAGAAGACGGAGATGCTAATTCATAA
GCAGAAAATGACGATGATGGTGATGATGATGAAGAGGAAGAAATTAAGGCAAGGGAAGGC
TGTAGTTTAGCATATGATGCTTTGAATATTAAATTTGTATAAGAAGAGAATGATTTGAAC
CCTTTATTTAAAAAGAATATGCTCTTTAAGCCAAATTATGTTCATCAAATTTATGGTTAA
GAAGAAGAAATAGAAGGTTATGAAGACCTACAAATTAATATTTATATGCTTTCAGGCTCT
CTCCATACATTAGTTGAATACTCTTATGGAAAAAAGATGAAATAGCATGAAGATTTTTTA
TAGAAGCTTCGTGATAATTGTTTTGTGAGTGATTTTTGTCTCAAGCGCAAAGAATTCAAT
TAGCATATGGCCAAAGAGAAGTCATTTAAACCAATTGGAGATAAATTCAAAGAAATAACT
GCAAAAAATGGAGAAAAATTTGAAATATATTATTGTAATACTTAAAAACACCCAGAATTC
TCTGAATATAAAAAGCGCATGCAAGTATTTGCTAAATTCTTTATCGAAGTAGGCTCCTAC
ATTGAAGATAATGAATATTGGCATCACTTCCTTATTTTCCATGTTGATTAGAATGGAATG
TACACTTTTGCAGGATTTACAAATAAATATGAATACATGTTTAACATCAATAAATCAAGA
CATTAAATTTCTTAGATTGTAATTCTTCCTATCTTCTAAAGATTAGGCCTTGCTACAGAG
CTTTTGAATTGTCACTATAAAACTGCCTAAGAAGATAGTAAGTGTTTAGAATTAACAGTA
GAGGATCCCTCACCTGAATTCCAAATCGTTAGAGATATTATTGAAACTAAATTAGTCATT
GATGGAAAGTTTTGGCAATGGTTTGAAGCTATTCGCCCAAAAACAATAAGAGGCATTCTT
TAGCTTGAAGGAATATAAATTAGTCACTAATAAGAAATTACCCAAGCTACTAAAATTCCT
AAATATTAAATATAAAGAATTTTTGAAATTCTTATGCTTAGCAAATTAGATTAATCAAAT
AAGTAGGTTATGGACAGATATAGAGGACATTTTATCAAATATAGAAAAGATGTTAATGAA
GTCAGAACTCAAAGAAAAGTTCCTTATATAATTTTTGATAATAAGGCTGTTAAAATTGAT
GTATAAGCTATCATTGAATAAAAAAAACAATTGGAGCCTAATGATGCCTTTTATTTAGAA
GAATATGAACAAACACTAGAACAATATAATAATGTAATTTAAAAACTCAAGATTTGA


>TTHERM_00046760(gene)
ATGTCTGATAAGAAAAACCAAAAAATTGACCTCTCTTAGTTTGAGGGTCCAGATGGAATG
CAAAAGCTAATGAAATTAGCTATGGAGTTCCAAGAAAATGAAAAATAACAAAAAGGATAA
AAAAAGAATAAAAAAAAAGTAGATTAAGACTTAGGAGAAGACGGAGATGCTAATTCATAA
GCAGAAAATGACGATGATGGTGATGATGATGAAGAGGAAGAAATTAAGGCAAGGGAAGGC
TGTAGTTTAGCATATGATGCTTTGAATATTAAATTTGTATAAGAAGAGAATGATTTGAAC
CCTTTATTTAAAAAGAATATGCTCTTTAAGCCAAATTATGTTCATCAAATTTATGGTTAA
GAAGAAGAAATAGAAGGTTATGAAGACCTACAAATTAATATTTATATGCTTTCAGGCTCT
CTCCATACATTAGTTGAATACTCTTATGGAAAAAAGATGAAATAGCATGAAGATTTTTTA
TAGAAGCTTCGTGATAATTGTTTTGTGAGTGATTTTTGTCTCAAGCGCAAAGAATTCAAT
TAGCATATGGCCAAAGAGAAGTCATTTAAACCAATTGGAGATAAATTCAAAGAAATAACT
GCAAAAAATGGAGAAAAATTTGAAATATATTATTGTAATACTTAAAAACACCCAGAATTC
TCTGAATATAAAAAGCGCATGCAAGTATTTGCTAAATTCTTTATCGAAGTAGGCTCCTAC
ATTGAAGATAATGAATATTGGCATCACTTCCTTATTTTCCATGTTGATTAGAATGGAATG
TACACTTTTGCAGGATTTACAAATAAATATGAATACATGTTTAACATCAATAAATCAAGA
CATTAAATTTCTTAGATTGTAATTCTTCCTATCTTCTAAAGATTAGGCCTTGCTACAGAG
CTTTTGAATTGTCACTATAAAACTGCCTAAGAAGATAGTAAGTGTTTAGAATTAACAGTA
GAGGATCCCTCACCTGAATTCCAAATCGTTAGAGATATTATTGAAACTAAATTAGTCATT
GATGGAAAGTTTTGGCAATGGTTTGAAGCTATTCGCCCAAAAACAATAAGAGGCATTCTT
TAGCTTGAAGGAATATAAATTAGTCACTAATAAGAAATTACCCAAGCTACTAAAATTCCT
AAATATTAAATATAAAGAATTTTTGAAATTCTTATGCTTAGCAAATTAGATTAATCAAAT
AAGTAGGTTATGGACAGATATAGAGGACATTTTATCAAATATAGAAAAGATGTTAATGAA
GTCAGAACTCAAAGAAAAGTTCCTTATATAATTTTTGATAATAAGGCTGTTAAAATTGAT
GTATAAGCTATCATTGAATAAAAAAAACAATTGGAGCCTAATGATGCCTTTTATTTAGAA
GAATATGAACAAACACTAGAACAATATAATAATGTAATTTAAAAACTCAAGATTTGA


>TTHERM_00046760(protein)
MSDKKNQKIDLSQFEGPDGMQKLMKLAMEFQENEKQQKGQKKNKKKVDQDLGEDGDANSQ
AENDDDGDDDEEEEIKAREGCSLAYDALNIKFVQEENDLNPLFKKNMLFKPNYVHQIYGQ
EEEIEGYEDLQINIYMLSGSLHTLVEYSYGKKMKQHEDFLQKLRDNCFVSDFCLKRKEFN
QHMAKEKSFKPIGDKFKEITAKNGEKFEIYYCNTQKHPEFSEYKKRMQVFAKFFIEVGSY
IEDNEYWHHFLIFHVDQNGMYTFAGFTNKYEYMFNINKSRHQISQIVILPIFQRLGLATE
LLNCHYKTAQEDSKCLELTVEDPSPEFQIVRDIIETKLVIDGKFWQWFEAIRPKTIRGIL
QLEGIQISHQQEITQATKIPKYQIQRIFEILMLSKLDQSNKQVMDRYRGHFIKYRKDVNE
VRTQRKVPYIIFDNKAVKIDVQAIIEQKKQLEPNDAFYLEEYEQTLEQYNNVIQKLKI