Identifiers and Description

Gene Model Identifier

TTHERM_00047010

Standard Name

DPL2 (E2F Dimerisation Partner Like)

Aliases

PreTt11180 | 3.m01639 | 3824.m02940

Description

transcription factor; Transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01755.1 9.997093137033517e-262
Description: transcription factor Dp-2 (792 aa)
WormBase WBGene00001061 0.0000000000005000841553255702
Description: locus:dpl-1 Transcription factor dpl-1 status:Confirmed UniProt:Q22703 protein_id:CAA92699.1
Oxytricha Contig13224.0.1.g9 0.0000000020002373268528243
Description: E2F/DP family winged-helix DNA-binding domain
DictyBase DDB_G0276799 0.0000029996948234116693
Description: tfdp2 on chromosome: 2 position 7346120 to 7348205

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29417875: Zhang J, Yan G, Tian M, Ma Y, Xiong J, Miao W (2018) A DP-like transcription factor protein interacts with E2fl1 to regulate meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 17(5):634-642
  2. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00047010(coding)
ATGAGCAAGCTACCTAGTGATAACGATGTCCTCTTTTAAAATAGGAGCGAAGAAGTGTTC
CCAAGAAAGCAGAAAAAAACTAATAAAGCAGGATATCCTAATCGAGGCAGCAATAACAAT
TATATAAATGGAAATTAGAATATAAAAAATTCAGCAATTTTAGAAGAGGAAGATGAGTAT
AAGAATAGTGTTAAATTTAATGGAGTTAAATCAGAAAATCCAGACAAATCTTAAAATATT
AGGCAATAGATTCTCTCAAAAAAATAGTCATCTCAGCTTTTTGAAAAAAATTAAATCGAA
GATGAAAACGCTCGAGGATTTGACTGTGTGTTCAATTAAAATACATCTAAGCCAATATCA
TCGAAGCACAAAGATTATGAGAATTCAATGTCCTCAAAAGGAGACTCCAAGTTTACTGTA
AAATCTGAATAATCCAGTATGCTCTTTGCTTCTAACCCTAACTAAATTAATAGCCCAAGT
ATCCACGATACCTCTAATATAAATAGTAAAATACTGCAGTAGTCAAGTCATCATCACTAA
ATTTCTAATAACAATCATAGTGAATTTCAAAATATATCCTCTAAAGTGACAAATTTAAAC
TCTTAAAAAGATAAATCTCAGGCAAATAGAACACAAATAGGCTCACAGCAATAACTGTCA
AAAAACTAAAATTCTATTACTCACTAATTAAATTAAAACTCTCACAATTTTCCATATTAT
CAGCCAAACAATCCAATTCTTTATCAACAAAGTCAAGGATTTTTTGATGCTGATTCAATT
AATTAATTAATAAAATAAGACTAATCTAATAAAAATAATAATAATAATAACAACAATAAC
AATAATAACATTCAAATAAATGGATCTTAAATATAATCTTAAGAATAAATATAATAACTT
TAATTACAAAGTATTTAAAACAAGTAGAGCTAACAAATGCTTTTCAATTCTAATTCATAA
AATCAAAACAGTAATTTTAATCATGATTTTATAAATAGTTAATTTGGATAAAACAGTTTA
TTATACGACTTAAACAATTCCCAACTTTTCAAAGATAGTATTTACTCGAATGGACTCACA
AGGAATTTGCTTCCTTAAAATGACTCAGATGTATTTGATAATGATGGAGGTATTGTAGAT
TATTTTTGTAATGACAAATAAGAAAACGATAACAAAGGAACATTACTAGGAAAAAACTTA
ATTTCAAGTTTTGCTCAATAAACCCAGCAAAATCACAAAAATCTCATATCTTCTCCAAGA
GGCTAAGCTAACAGCTTTTAGTTTCCCAACTAAGGCTTCAAAAAATCTTAAGTCAAGTAA
GAATCACTACTTTCATCTAACTAAAATGATTAAAATAATTTGATAGATTAAGCAAGATCT
TAAGTTGACGATTATAGTAACAATGGCGAATAAACTGAAGAAAGATAAACTTTAAGAGGA
TTAAGAGCCTTATCTTTAAAAGTAAAGGAAATAGTTTAGGAAAAAGGATCTACTACATAC
AAAGAGGTAGCAGAAACACTTGTACAAAATCTAAAATCAGGTCAAAAATAATTAGCTGAG
AAAGAAGATATTAAAGACGAATAAAATATTAAAAGAAGAGTTTATGATGCATTAAACGTC
TTAATTGCTTCTGAGGTAATTGCTAAAAAAGGCAAAAAGGTGCTAGCTATCGCAAAAACA
AATTTAGCTGGTAAATGCCTAAAGCATGATAATTGGAAAGAAGCAAAAGAAAAGCAAGAT
ATTTTAGATAAGTAAAAGTAAAAAGTCAACTAGAAAAAAGATCAAGTTAAAGAGTTAGCA
AGAAAATATGTTGCTCTTAAAAATCTTATAAGCAGAAATTAGTCTAGTGAAAAAAATACT
TAGATGAATTCTTAGTTATTTGAAAACTTCATCAACCAAAAGGATGAATATGACGATAAC
TAAAAATTCTTTATTAATTCTTAACTTTCAAATAAATCACAAACTCAAGGATTGAGAGAT
AAGATACTTTAACCTTTACTAGATGTCTAAAAACAAAAATTCTAATTCCCCGTTTTATCA
GTGAGATTTAATCCTGATGATTAATAGAGAGTGATCATGAAAATGAGCAAAGATAAAAAT
AATCTTAAGATATATGCAAAGGGATATCTTGAAACTTATGGAGACTTAGATATATTATGT
CAATTAAGTTTAGACAAAGTTTAGGATTAGTTTAGACAACAAGTGCTAGGAGATAAATAT
CTTAATTGGATAAACTCAGTTGACCATATAAAAACAGAACATATTGTAGAAGAAGATAAT
GAAAATCAATACCCAGGACCTTACATGATGAATGATTAGAATAATTATTGA


>TTHERM_00047010(gene)
ATGAGCAAGCTACCTAGTGATAACGATGTCCTCTTTTAAAATAGGAGCGAAGAAGGTACC
ATGAATACATCTTTATTAAAAAATAGCTATTGATAGAAACAAATTTTAGCATAAAAGCAA
TTGTAAAATAAAATACAAAATGCAAATTTAGAATATTAATGAGTTTATTGCATCATTTTT
AAATAGCATCCAGCATAGCTAAATCAACAAAATTACAGCAAATTGAGTACTCGGTATTTT
TTCATTCTTATTTCTTTTTATAAAAAATATAGTGTTCCCAAGAAAGCAGAAAAAAACTAA
TAAAGCAGGATATCCTAATCGAGGCAGCAATAACAATTATATAAATGGAAATTAGAATAT
AAAAAATTCAGCAATTTTAGAAGAGGAAGATGAGTATAAGAATAGTGTTAAATTTAATGG
AGTTAAATCAGAAAATCCAGACAAATCTTAAAATATTAGGCAATAGATTCTCTCAAAAAA
ATAGTCATCTCAGCTTTTTGAAAAAAATTAAATCGAAGATGAAAACGCTCGAGGATTTGA
CTGTGTGTTCAATTAAAATACATCTAAGCCAATATCATCGAAGCACAAAGATTATGAGAA
TTCAATGTCCTCAAAAGGAGACTCCAAGTTTACTGTAAAATCTGAATAATCCAGTATGCT
CTTTGCTTCTAACCCTAACTAAATTAATAGCCCAAGTATCCACGATACCTCTAATATAAA
TAGTAAAATACTGCAGTAGTCAAGTCATCATCACTAAATTTCTAATAACAATCATAGTGA
ATTTCAAAATATATCCTCTAAAGTGACAAATTTAAACTCTTAAAAAGATAAATCTCAGGC
AAATAGAACACAAATAGGCTCACAGCAATAACTGTCAAAAAACTAAAATTCTATTACTCA
CTAATTAAATTAAAACTCTCACAATTTTCCATATTATCAGCCAAACAATCCAATTCTTTA
TCAACAAAGTCAAGGATTTTTTGATGCTGATTCAATTAATTAATTAATAAAATAAGACTA
ATCTAATAAAAATAATAATAATAATAACAACAATAACAATAATAACATTCAAATAAATGG
ATCTTAAATATAATCTTAAGAATAAATATAATAACTTTAATTACAAAGTATTTAAAACAA
GTAGAGCTAACAAATGCTTTTCAATTCTAATTCATAAAATCAAAACAGTAATTTTAATCA
TGATTTTATAAATAGTTAATTTGGATAAAACAGTTTATTATACGACTTAAACAATTCCCA
ACTTTTCAAAGATAGTATTTACTCGAATGGACTCACAAGGAATTTGCTTCCTTAAAATGA
CTCAGATGTATTTGATAATGATGGAGGTATTGTAGATTATTTTTGTAATGACAAATAAGA
AAACGATAACAAAGGAACATTACTAGGAAAAAACTTAATTTCAAGTTTTGCTCAATAAAC
CCAGCAAAATCACAAAAATCTCATATCTTCTCCAAGAGGCTAAGCTAACAGCTTTTAGTT
TCCCAACTAAGGCTTCAAAAAATCTTAAGTCAAGTAAGAATCACTACTTTCATCTAACTA
AAATGATTAAAATAATTTGATAGATTAAGCAAGATCTTAAGTTGACGATTATAGTAACAG
TAACCAACTAACTAACTTTATTTCTTCTACAATTTAAATTAAATCATTTCATTTTTAAAA
AGATGGCGAATAAACTGAAGAAAGATAAACTTTAAGAGGATTAAGAGCCTTATCTTTAAA
AGTAAAGGAAATAGTTTAGGAAAAAGGATCTACTACATACAAAGAGGTAGCAGAAACACT
TGTACAAAATCTAAAATCAGGTCAAAAATAATTAGCTGAGAAAGAAGATATTGTAAATTT
TTCATAAATAAAATTAACTATTTTATAACAAAAAAAGATTTTTTTTCAAAATTTTAATTA
AAAAACGGGAAAAAAAATTTCTTTTATTAATTGAAAAATTAAGCATTTGTTTTTTTACTA
AAATATTCTTATTTATTTATAGAAAGACGAATAAAATATTAAAAGAAGAGTTTATGATGC
ATTAAACGTCTTAATTGCTTCTGAGGTAATTGCTAAAAAAGGCAAAAAGGTGCTAGCTAT
CGCAAAAACAAATTTAGCTGGTACTATTTGATTCCTTGTAAAAATTTTACCATAATTTAT
TAAATTTTAAAAATAAGGTAAATGCCTAAAGCATGATAATTGGAAAGAAGCAAAAGAAAA
GCAAGATATTTTAGATAAGTAAAAGTAAAAAGTCAACTAGAAAAAAGATCAAGTTAAAGA
GTTAGCAAGAAAATATGTTGCTCTTAAAAATCTTATAAGCAGAAATTAGTCTAGTGAAAA
AAATACTTAGATGAATTCTTAGTTATTTGAAAACTTCATCAACCAAAAGGATGAATATGA
CGATAACTAAAAATTCTTTATTAATTCTTAACTTTCAAATAAATCACAAACTCAAGGATT
GAGAGATAAGATACTTTAACCTTTACTAGATGTCTAAAAACAAAAATTCTAATTCCCCGT
TTTATCAGTGAGATTTAATCCTGATGATTAATAGGTATTTTAATTCGTTTTAAAATTATA
AATTAAAAAATTTTATTTACAAAATAATTTCATTTAGAGAGTGATCATGAAAATGAGCAA
AGATAAAAATAATCTTAAGATATATGCAAAGGGATATCTTGAAACTTATGGAGACTTAGA
TATATTATGTCAATTAAGTTTAGACAAAGTTTAGGATTAGTTTAGACAACAAGTGCTAGG
AGATAAATATCTTAATTGGATAAACTCAGTTGACCATATAAAAACAGAACATATTGTAGA
AGAAGATAATGAAAATCAATACCCAGGACCTTACATGATGAATGATTAGAATAATTATTG
A


>TTHERM_00047010(protein)
MSKLPSDNDVLFQNRSEEVFPRKQKKTNKAGYPNRGSNNNYINGNQNIKNSAILEEEDEY
KNSVKFNGVKSENPDKSQNIRQQILSKKQSSQLFEKNQIEDENARGFDCVFNQNTSKPIS
SKHKDYENSMSSKGDSKFTVKSEQSSMLFASNPNQINSPSIHDTSNINSKILQQSSHHHQ
ISNNNHSEFQNISSKVTNLNSQKDKSQANRTQIGSQQQLSKNQNSITHQLNQNSHNFPYY
QPNNPILYQQSQGFFDADSINQLIKQDQSNKNNNNNNNNNNNNIQINGSQIQSQEQIQQL
QLQSIQNKQSQQMLFNSNSQNQNSNFNHDFINSQFGQNSLLYDLNNSQLFKDSIYSNGLT
RNLLPQNDSDVFDNDGGIVDYFCNDKQENDNKGTLLGKNLISSFAQQTQQNHKNLISSPR
GQANSFQFPNQGFKKSQVKQESLLSSNQNDQNNLIDQARSQVDDYSNNGEQTEERQTLRG
LRALSLKVKEIVQEKGSTTYKEVAETLVQNLKSGQKQLAEKEDIKDEQNIKRRVYDALNV
LIASEVIAKKGKKVLAIAKTNLAGKCLKHDNWKEAKEKQDILDKQKQKVNQKKDQVKELA
RKYVALKNLISRNQSSEKNTQMNSQLFENFINQKDEYDDNQKFFINSQLSNKSQTQGLRD
KILQPLLDVQKQKFQFPVLSVRFNPDDQQRVIMKMSKDKNNLKIYAKGYLETYGDLDILC
QLSLDKVQDQFRQQVLGDKYLNWINSVDHIKTEHIVEEDNENQYPGPYMMNDQNNY