Identifiers and Description

Gene Model Identifier

TTHERM_00047170

Standard Name

RRM61 (RNA recognition motif-containing protein 61)

Aliases

PreTt11196 | 3.m01877 | 3824.m02955

Description

RRM61 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01741.1 2.0004037638327014e-151
Description: hypothetical protein (295 aa)
Oxytricha Contig17921.0.g78 2.99915080840225e-45
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
DictyBase DDB_G0275459 9.995317835403734e-19
Description: DDB_G0275459 on chromosome: 2 position 6113524 to 6114624
WormBase WBGene00008688 0.00000000000003999587784428659
Description: status:Confirmed UniProt:Q95QL3 protein_id:CAC70081.1
SGD YGR159C 0.00000000000003999587784428659
Description: NSR1 Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047170(coding)
ATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTAATCAAAAACCAAAATAA
CCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATAAATACCTTTAATTAGCA
TTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAAAAAAAGTAGAACAAAGC
AACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAAAACGCTCAGTATTCGTT
TCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAATATTTCTAAAATTGTGGA
ACTATTGAAAATATCAAGCTTCCTAGATACTAAGATACAGGAAAGATTATAGGATATTGC
CATCTTGTTTTTTCAACTCCAGAAGAAGCTTAAGAGGCAATCAAATTAAATAAGCAAGTC
ATGAATGGTAGATACTTAGATATTTCACTTGCTAAGGGTGAAAAAAAAGTAGAGTACAAG
AATGATGTTAAGGCCCCTGAAGACTGCACAACAATATTCGTTAAAAACCTTGCATTCGAT
TGTACCGAAGATGAAGTTGGTGAGTTCTTTGAAAAATGCGGAAAAGTAGTTAATGTTAGA
TTCGTTTATCACTACTCTCAAAAGCACTTTAAAGGATTTGCTTTTATTGAATTTAAGATG
AACAGTTCAGTAAATGCTGCTCTTAAGTTAAATGGTACTGAATTCAAGGGTAGAAAACTC
ACAATTGATTATGAAGTTGGTTCTTAGAAGAAGGGTTTCCGTTTTAAATAGACTTAAGAT
GGCAATTAAAAATACAATAAATAGTACGAAGAGATTGTTGAATAAAAAGAAAAAAAATAG
AAGAAAATTCAAAAATTCGATAAACTTAAAAACTTTAATAACAAAAAGAAAGATTTCCCT
TAAAAAGGTAAAAAGGAAAATCTTAAGCTTTTCAAGAAATGA


>TTHERM_00047170(gene)
ATGAATGAAGCAAAACAATTAGTAAACAAAGTATCCAAAATTAATCAAAAACCAAAATAA
CCAAGAATATTTTTTTACTTATTTTATTATTAATTATCAAATAAATACCTTTAATTAGCA
TTAGCAATAAATATAAAACAGTAGTAGAAAAAAGAAATGGGAAAAAAAGTAGAACAAAGC
AACACAACCGTTGAAGTTTAAGAAAACAACGACCCTTCATTAAAACGCTCAGTATTCGTT
TCAGGATTACCTTATTCAGCTGATACTGATGCTATCAAAGAATATTTCTAAAATTGTGGA
ACTATTGAGTAAATAATTCTTTCTAATTCTTTAATAATTACAAATTACCTGCAAATGAAA
TTTTTATCTTTTAATCTTTATTTTATTTTTTATAGAAATATCAAGCTTCCTAGATACTAA
GATACAGGAAAGATTATAGGATATTGCCATCTTGTTTTTTCAACTCCAGAAGAAGCTTAA
GAGGTATTTAATTTCTTTGAATCTTCATAGTCTAATATATTAAAGAGCTTTAAAATATTC
ATAAAAAGGCAATCAAATTAAATAAGCAAGTCATGAATGGTAGATACTTAGATATTTCAC
TTGCTAAGGGTGAAAAAAAAGTAGAGTACAAGAGTAATAAATTTATTTAATAAGATGAAT
TTAAAAAATCAAGCTTTTTATTCTTGAATTAAATTCTTAAGTGAGAGTTAGTAAGTTAAA
TTAAGCCACTTTTTGTAAAATTAAAAGATGATGTTAAGGCCCCTGAAGACTGCACAACAA
TATTCGTTAAAAACCTTGCATTCGATTGTACCGAAGATGAAGTTGGTGAGTTCTTTGAAA
AATGCGGAAAAGTAGTTAATGTTAGATTCGTTTATCACTACTCTCAAAAGCACTTTAAAG
GGTAAATTAATTTATTAAAATTATCTGATTACTACTGATCAAACAAAATAAGCTAAAGGC
TTAAAGTTCTAAATAGTTAGTTAATAATTCTTCCTTAAAAATTAGATTTGCTTTTATTGA
ATTTAAGATGAACAGTTCAGTAAATGCTGCTCTTAAGTTAAATGGTACTGAATTCAAGGG
TAGAAAACTCACAATTGTAATAAATTTATTAAGCATTCATACATATTTTATCATTCTTAA
TTATTTTATTTATTTATTTATGAAGGATTATGAAGTTGGTTCTTAGAAGAAGGGTTTCCG
TTTTAAATAGACTTAAGATGGCAATTAAAAATACAATAAATAGTAAATTAAATAATTCAT
TAATTAGCATAAATAATAAATAATACTTTTAAAATAAATTAAGGTACGAAGAGATTGTTG
AATAAAAAGAAAAAAAATAGAAGAAAATTCAAAAATTCGATAAACTTAAAAACTTTAATA
ACAAAAAGAAAGATTTCCCTTAAAAAGGTAAAAAGGAAAATCTTAAGCTTTTCAAGAAAT
GAAAATAAAACATTAATTTATTAATTTCTATGTTATCCAGTTTATATTCTATACACAACT
ATGCATACATGGATTCAATTTTAAATTATCTCTGGCTTTCAAGCAAAATTCATTTTTTAT
TAAAATCTAAAACTAAAATTAATAATTTTTTTCAAATTGCAAAAACAATTTTGAGCTTCA
AATCAACTCTTTAATAATTAAAATTACTTTTTGTAAACATATTTTTCAAAAATTTTTTTT
ACTTACAATTAATAATTATGAAATAGCCTTCATAAAATAAATTTAATATTTATTTATTAA
AATAAATAAACTTTTTTAATTATGATAATTTTTTAATTAATTTAAAGACATAAGTTAGTT
AGTATAAAAAAGTATTTAAATTAATAATTCCTCTAAATTATCCAATTTTAATTTATTTTA
CATAAATTTTTTAATTTTTAAGAACTCTAAATAATATGCTTAAATTTAATTTGTAATTCT
CTTAAGAGTATTTTCGGGAATTATGTTTTTCATATAAGCTCAACAAAAATAAAGTTAATT
TTTAAAAAACATAAATTATTAATAAGCCAAAAAGAAATATAACAATTTATTTGTTCTATT
TGA


>TTHERM_00047170(protein)
MNEAKQLVNKVSKINQKPKQPRIFFYLFYYQLSNKYLQLALAINIKQQQKKEMGKKVEQS
NTTVEVQENNDPSLKRSVFVSGLPYSADTDAIKEYFQNCGTIENIKLPRYQDTGKIIGYC
HLVFSTPEEAQEAIKLNKQVMNGRYLDISLAKGEKKVEYKNDVKAPEDCTTIFVKNLAFD
CTEDEVGEFFEKCGKVVNVRFVYHYSQKHFKGFAFIEFKMNSSVNAALKLNGTEFKGRKL
TIDYEVGSQKKGFRFKQTQDGNQKYNKQYEEIVEQKEKKQKKIQKFDKLKNFNNKKKDFP
QKGKKENLKLFKK