Identifiers and Description

Gene Model Identifier

TTHERM_00047480

Standard Name

RPS1 (Ribosomal Protein of the Small subunit 1)

Aliases

PreTt11227 | 3.m01917 | 3824.m02985

Description

RPS1 40S ribosomal protein S3a; Homolog of yeast RPS1- human RPS3A

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01703.1 2.9990501533945683e-168
Description: ribosomal S3Ae family protein (266 aa)
SGD YLR441C 3.9997119520108244e-79
Description: RPS1A Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein
Oxytricha Contig850.1.g11 7.000846320060671e-65
Description: Ribosomal S3Ae family
WormBase WBGene00004470 3.0014802379878627e-60
Description: locus:rps-1 40S ribosomal protein S3a status:Confirmed UniProt:P48154 protein_id:CAA83605.1
DictyBase DDB_G0277345 2.9997246065828143e-59
Description: rps3a on chromosome: 2 position 7795600 to 7797187
Stentor Coeruleus SteCoe_1787 1.8048513878454153e-35
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00047480(coding)
ATGCTCTACATAAAAAAAAAAATAATTACCATCTAATTTGGGTCTCTTGAGAACCTTAAC
CTTTCTAATGGTGATGTTTTAGAGAGGGAAGATGTTCTTGGTTTCCTTTTCAATCTTCTT
GGTGTAGTCTTCTCCGATGAGGTTCTTGGAGAATTCAGCAATACCCAACTTAGCGGCTTC
ATTGGTGATGAAGGTGTTGATCTTTCTTCTGATGGCTCTGACTTGAGAAGACTTAGCATA
ACAAGTAGAGGTGGAAGATTGCTTACCAGCAGAGGTCTTCTTGGTGAAAGCAAGAGTGAA
AACTCTGATGATGTAACCGTCGTTGGTCTTGCAGTCAACTCTAGCTTCGATGAGAGTTTA
CCACTTTCTGATCATGGAGCATAATCTGTCTCTGGTGATGTCCAAACCGTAGAAAGAGAG
GAGAGAAATAGTAATCATGATGGAAAAATTCTTACTGTTGCCGGAGCTCTTGGTGACGAG
GGTCTTACCGAAGGACTTGGAGGAGAAGGGGATGGGGGCTCTGAAGTCGTACCATTCCTT
TCTAGAAAGGGGCTTTGA


>TTHERM_00047480(gene)
ATGCTCTACATAAAAAAGTAATGATTTGCTTTTTATATATGTATGATTTTAAAATTTACA
ATATCAAATTATAATCAAAATTCATAAATTTAAAAAAAAAAAGGATATTATCATTTAAAC
AACTCAATATTTCTTAAATATACTAAGAAATTTTTTTAAAGTTTAATGAGCTTTAAAAAA
TAATTATTTACAAAATATTAAATTAATTTTAATAAAATACCACTTAATAATTGAAAATAA
ATTATAAAATAAATACAATATTTAGTTCAAAGGAGAAACAGAGTTTACATACTAAATTTA
CTTTAAACTTAATAAATACTTTGATTCAAATTCTTAATAAAACTATAAAGTATCAGGATA
TTTTAAATGTGGATATATTGATAATCAGATTTATAATTATGATAAACTAGATTTATTATT
GAGGTATCCTTTTTATTTTTTTGTTTATTTTATAGATTTAAAATAATTTATTATAATAAA
ATATTAAAATTTAAAAATAATTTATTATAATAAAATATTAAAATTTAAAAATAATCAAAA
CCTTTTAAATGTTAAAACCTAAACTTAAAATTTTTGAAAAATTCTTTTGATTGAACAACT
AATGAGAAAATTTTATATTATAATTTTATTATGTTTAGAATATTTAAATAAATACAATCT
GATTTAAGAAAATAATGGAATTATATGTAGATTTTTTATAATTTAAATAATTTTAAAAAA
TCTCTTTTTTTTTAAAATAAAAAACTTAAAATAATGAAAATATATTGATGAGCCTTGATA
TAAATAATAAAATCTATTCATTTTAATTATTTTGATTGGTTTCTTAAATAAATGGATATT
CTTTTTGGTTGTTTTTATAATATCAATGCATAAATGATTTATTTAATTTTTTTTTACAAG
ATATACAAAATGTTTATTAACTTTTTATGTCAATGTGATAAGTGAGTGTGTTAAATTTAA
ATAGATTTAAATCAGTCAACATAAAAGATCAACAAAAAATCTTTAAATTTTATACTTAAA
TCAATCGTTTTACTATAAGTTAAAGTATTTAAAATTGTTTAAATTTATATATTCATTATT
TTTTTCACTAGGCGAGCAAGTTTTAGGCAGCTTATTCTTCGGGGGCACCATCTCTACCAG
TAGCCTTTTCACCCTTCTTTTCGTGGGAGTATAATTCAGCGATCTTAGTAGCTATTTTAT
GAAAAAGTAAAGATTAAAAATATGAAATTAAGAATGAGAAAAATAAATAAATTTAAATTT
TGTTAAGAAAAATAATTACCATCTAATTTGGGTCTCTTGAGAACCTTAACCTTTCTAATG
GTGATGTTTTAGAGAGGGAAGATGTTCTTGGTTTCCTTTTCAATCTTCTTGGTGTAGTCT
TCTCCGATGAGGTTCTTGGAGAATTCAGCAATACCCAACTTAGCGGCTTCATTGGTGATG
AAGGTGTTGATCTTTCTTCTGATGGCTCTGACTTGAGAAGACTTAGCATAACAAGTAGAG
GTGGAAGATTGCTTACCAGCAGAGGTCTTCTTGGTGAAAGCAAGAGTGAAAACTCTGATG
ATGTAACCGTCGTTGGTCTTGCAGTCAACTCTAGCTTCGATGAGAGTTTACCACTTTCTG
ATCATGGAGCATAATCTGTCTCTGGTGATGTCCAAACCGTAGAAAGAGGTCTTAGCGTTT
CTACCATCGACTTCATCGATAACCAACTTAACCTTTCTCCTATTATATTCAAAACATGAT
TAGTAACAGAATTTTCTAATATATTTTTTATTTATATCCTTATCATCTACTTATTTATCA
CAGGATCAAGCCAAAAGATATTAAATCGTTTTAGCTAAAATTCTAAGAATTAATTTTGCT
TTGAGAAATAAAATTTTGAATTAATTCAAAAATAAATATCCTAAAATTTATTTAAATTTT
TTTGTTGATTTTGGCTCCCTTTTTAAAAGTATGGAATCAATCCTTTTTCTAATTAATCGA
TAAAAGATATTAAAAAATAACTGCTATTTTCTTTTCAAAAGATCAATTTTTAGTTATGGA
TTGCTTTTTTTAATTTATTTTTAATAGAAAGTTTATTAACTTTAAAATATATCATTTGTT
TTTATGGGAGTATGCATGCATGTATGTATCTTTATCTATTGTTTCTTTTATAGCTAATTC
AATAAACAAATTGATTTAGTTATTGTGTATAGAAAATCAGCGATGGTTATTTTTTTATTT
ATTTATTAATAGCTAAACTAAATTGATTTAAATATTTTTTATTCTTCATTTATAATTTAT
TAGCAAGTAAGTTGGTTTGCATGCATTATCAACATGCCTGAAGTCATTATTTACTCAAAG
CAAAGTTTGATAAGTAGATAAGGTTGCTTTATATATTTTGTAATTAAAAATCATACCAGG
CCTTGTCATTAGAGTTATCCTTGAGATCAGCGAGAGTGGATTCAACGACTCTACCCTTAA
TTTCTTCAGAAGCAATTCCTAATAAAATAAAATATTAAGTTAATTATTTGGATTGATATA
GTTTATTGAGAATGTTGGATTTTCAAAACGTGAATTGCTGTTTGTTGATTTTCGACTCAT
TTAATTGATTATGTTATTTAAAAATCTTTAGCCTCAGTTAATCCGAAAAAAAATTTTAAT
TTTAAAATATTTTATGTATCAAATGAGTAAGGGTTTCTAGATATTTCATTTTAGATAGTA
CAATTAACATTAATGTGGTATCTCTTTATTTGGATTAATTAAGTGAGGAGAAAATAAGTA
ATTAGATAAAGTGTCAATCAACCCATATGCTAACAAATTAAAAGATATCTACAATTAATT
CCTTTATATTTTAGAGAGCATTTGGATACGGATATCGAAAGTAGCTAATTTTTTAATTCC
TTTTCTCCTTAATCGCATTCAATTCAATTTATTTAGTATATACCAATTTCAATTTGTCTT
TTGCTAACTTTAAATGCTATTCGCTAATCTCTTTTTTTACATTAACTATTATTTTTTTTT
CTACATATTTAACAGATTTGATTAATTTATTAATTAATTGTCCTATTCACAATTTGAACT
TGTACGATCTAAATGAGTAAGCTTGAAGTTAGTGGTGAAATAGTTTACTAATATGTGCGA
CTCGGTGAATGTTATATAATCGTTTATCATTTAAAGGAGATTTAAAGTTGTCAGATATTC
GAAAAAATGGCGATATTCAAAAAATGCAATTCGTTTTGAAAATAAGGAAAATAGAGGAGA
GAAATAGTAATCATGATGGAAAAATTCTTACTGTTGCCGGAGCTCTTGGTGACGAGGGTC
TTACCGAAGGACTTGGAGGAGAAGGGGATGGGGGCTCTGAAGTCGTACCATTCCTTTCTA
GAAAGGGGGTCGATAGTTCTCTTCTTGGCGCCCTTCTTACCACCACCAGCCTTCAAACCA
GGATTCTTACCTTGAGTCATTTTTACTTTTGTTCCTTTTTTGTTTTGTGTTTTATTATCT
TTAATTATTTCTTAAAAAATTACCCTTGTATTGCTTTTTTAGCTTTGA


>TTHERM_00047480(protein)
MLYIKKKIITIQFGSLENLNLSNGDVLEREDVLGFLFNLLGVVFSDEVLGEFSNTQLSGF
IGDEGVDLSSDGSDLRRLSITSRGGRLLTSRGLLGESKSENSDDVTVVGLAVNSSFDESL
PLSDHGAQSVSGDVQTVEREERNSNHDGKILTVAGALGDEGLTEGLGGEGDGGSEVVPFL
SRKGL