Identifiers and Description

Gene Model Identifier

TTHERM_00047490

Standard Name

MRNC60 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt11228 | 3.m01942 | 3824.m02986

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01702.1 9.997093137033517e-262
Description: hypothetical protein (412 aa)
Oxytricha Contig5991.0.g70 3.00017180903994e-49
Description: MORN repeat
Stentor Coeruleus SteCoe_21310 5.900090541597061e-29
Description: None
DictyBase DDB_G0349488 3.99801309251602e-27
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 4.0009493637353324e-18
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047490(coding)
ATGTCTTAATCCATTACAAATAGCTAGTTTTTATACTAAGGTGGCTACCCAGCTAACTCA
CCTCCTAGAAAATCATTTTAACCTGAAAAGGAAAGAGAATAGGTTTTGTTAAGAAAAGAA
GAAATCATTAATGAATTCCGTAATACATACTTAAAAAATACATCTGAAACTGATAAATTG
CAATAATTAACTTATGCTGATGGAGCCACTTATATTGGCTAAATTAGAGATAAGAATGTC
AAGCATGGCAAGGGTATGTACACTTATCCTAATGGAGATATTTACCTTGGTGACTGGAAA
GATGACTTCTTCAATGGAAATGGTGTTTATATTTTTAGTATTGGTGAAAGATATGAAGGC
CAGTTAATTAATGGATACAAGCACGGTCGTGGAAAATACTTCTATGTAAATGGAAATGTC
TACTAAGGAGAATGGAGAGAAGATAAAAAAGATGGTCGTGGTGTTTATTAATACAATACT
ACAGGTGAAAAGTATGAAGGTGAATGGAGAAATGGTGAAAGACACGGAAAAGGAACCTAC
TATTTCGCTTTTGGAGATGTTTATGATGGATCTTGGGAAAATGGATGCAAAAATGGATAT
GGTGTTTTGACCTATGCTTCTGGTGCTAGATATGAAGGCATGTGGGCAAGAGATCGTGCT
AATGGTCGTGGTATTATGTACTATGCTAACAACGATAAATATGATGGTGAGTGGGTTGAC
GGTGCTAAGCAAGGTAAAGGTGTTTACTATTTCCATGATGGTAGTCGCTACGAAGGTGAT
TGGGTATAGGACTATAAGAATGGTATTGGTTTGTTTATTCATGTCAACGGAGATAGATAT
CAAGGTGAATTTAAGGAAGGAGAAAAGAGTGGTAAAGGTGTTTACAACTATAGCAATGGT
GATAGATACGAAGGTGAGTGGTAAAATGATAAGAGACATGGTCGTTTAGGTACTTTATAC
ATGCAAAATGGCGATAGATACTCTGGTGAATGGAAGGACGGAGAAAAGAATGGATAAGGT
GTTTATGAATTCTCCAATTTCGATGTCTATGAAGGCTATTGGTTGAACGGAAAACGTCAT
GGTAAAGGTATCTACAGATGGAATAATGGAGAACACTACAACGGTGATTGGAAGAATGAT
AGAATGAATGGCTACGGAGTCTTCACAAAGGTTGATGGTTCTGTTTATGAAGGTGAATTT
AAAGACGATGTTGCTGTTTAATAACCTTACTGA


>TTHERM_00047490(gene)
ATGTCTTAATCCATTACAAATAGCTAGTTTTTATACTAAGGTGGCTACCCAGCTAACTCA
CCTCCTAGAAAATCATTTTAACCTGAAAAGGAAAGAGAATAGGTTTTGTTAAGAAAAGAA
GAAATCATTAATGAATTCCGTAATACATACTTAAAAAATACATCTGAAACTGATAAATTG
CAATAATTAACTTATGCTGATGGAGCCACTTATATTGGCTAAATTAGAGATAAGAATGTC
AAGCATGGCAAGGGTATGTACACGTAAGGCTTTAACATTTTTAATTTATCTAATAGCTTA
TACAAAATAAGCCTATTAATTACTTAATAGAAATTTTTTTTTTGATATTGCTGTTTTATA
AACCCTCAACAAATTCTGGCATTTTTTACTGAATTTAAACTTTTTTTAGAGATCTTCAAA
AGCAAATTGGATTTTAGATCCTAAAATGATACTTTACATAAAGATAGATAAAATATCAAA
TATTAAGCTTTAAATAGCATAATGAATATCTACTTTTAATTTAAATATTCTTAAGAGCTT
CCCTAATTTAGAAGGTTGTTCTAGCTTCAAACTTTAATCACTAAATAAACATTTTTCGTT
TCAATTCAAGCAAATATTTAGATTTTTTTTGCTAATACTTAAATTAAATAATTTTAATTT
TAAATTTAGTTATCCTAATGGAGATATTTACCTTGGTGACTGGAAAGATGACTTCTTCAA
TGGAAATGGTGTTTATATTTTTAGTATTGGTGAAAGATATGAAGGCCAGTTAATTAATGG
ATACAAGCACGGTCGTGGAAAGTAATAAATATAATAAACTTATATATAAAAAGCAACGTT
TTATTGTTTAGTAAAACAAAAAAATAGCTAATAATTCATTTTCAAAAAGGTTTTTGAAAC
ATTATCTTAGGTTAATAAAAGAAAAGGAAAATTTTATTATAATCTTTTTTTAGAGATGTT
AGGATATTGAGGTTTAACTTAAAAGAAAAAAAATTATAAAATAAAACAAAGAATATTATT
TGAAAATAAGTGCTATAAAATAAAACATTTTGCTAGTGAAATAGTGTTGAAACAAATAAA
AATAATATTTTATTTATTTATAAATAGATACTTCTATGTAAATGGAAATGTCTACTAAGG
AGAATGGAGAGAAGATAAAAAAGATGGTCGTGGTGTTTATTAATACAATACTACAGGTGA
AAAGTATGAAGGTGAATGGAGAAATGGTGAAAGACACGGAAAAGGAACCTACTATTTCGC
TTTTGGAGATGTTTATGATGGATCGTAATCATTAAAAATAATTTTTAAATCAAATATTTT
CACATTTTTTTATCTAAATTTATTTAATAAAGCTTTAAATAAATATCTATTTATAAATTA
AAGATTTAATGTAAATGTAATTTAAAATTAAATTTAATTAAAAATAGTTGGGAAAATGGA
TGCAAAAATGGATATGGTGTTTTGACCTATGCTTCTGGTGCTAGATATGAAGGCATGTGG
GCAAGAGATCGTGCTAATGGTCGTGGTATTATGTACTATGCTAACAACGATAAATATGAT
GGTGAGGTAATATAATAAATAACAAATGTATTATTAAAAAATCAACCAATTTATTTATAA
ATTTATTGAAGTGGGTTGACGGTGCTAAGCAAGGTAAAGGTGTTTACTATTTCCATGATG
GTAGTCGCTACGAAGGTGATTGGGTATAGGACTATAAGAATGGTATTGGTTTGTTTATTC
ATGTCAACGGAGATAGATATCAAGGTGAATTTAAGGAAGGAGAAAAGAGTGGTAAAGGTG
TTTACAACTATAGCAATGGTGATAGATACGAAGGTAAATAATTAATTTTTTTAAATAAAA
AACAGATAGTGAAGAGTTTTTAGATAAATTTAGAATTGCATTTTTAACTTTAATGATGAA
ATCATAAGAAATAAAATAAATGTAAATTTATTTAATATAATTAAAGGTGAGTGGTAAAAT
GATAAGAGACATGGTCGTTTAGGTACTTTATACATGCAAAATGGCGATAGATACTCTGGT
GAATGGAAGGACGGAGAAAAGAATGGATAAGGTGTTTATGAATTCTCCAATTTCGATGTC
TATGAAGGCTATTGGTTGAACGGAAAACGTCATGGTAAAGGTATCTACAGATGGAATAAT
GGAGAACACTACAACGGTGATTGGAAGAATGATAGAATGAATGGCTACGGAGTAATTTAT
TTATTTATTTATTTAATTATTTTCTAAATTTGGAATTAAACTTATAAATGAAAGGTCTTC
ACAAAGGTTGATGGTTCTGTTTATGAAGGTGAATTTAAAGACGATGTTGCTGTTTAATAA
CCTTACTGA


>TTHERM_00047490(protein)
MSQSITNSQFLYQGGYPANSPPRKSFQPEKEREQVLLRKEEIINEFRNTYLKNTSETDKL
QQLTYADGATYIGQIRDKNVKHGKGMYTYPNGDIYLGDWKDDFFNGNGVYIFSIGERYEG
QLINGYKHGRGKYFYVNGNVYQGEWREDKKDGRGVYQYNTTGEKYEGEWRNGERHGKGTY
YFAFGDVYDGSWENGCKNGYGVLTYASGARYEGMWARDRANGRGIMYYANNDKYDGEWVD
GAKQGKGVYYFHDGSRYEGDWVQDYKNGIGLFIHVNGDRYQGEFKEGEKSGKGVYNYSNG
DRYEGEWQNDKRHGRLGTLYMQNGDRYSGEWKDGEKNGQGVYEFSNFDVYEGYWLNGKRH
GKGIYRWNNGEHYNGDWKNDRMNGYGVFTKVDGSVYEGEFKDDVAVQQPY