Identifiers and Description

Gene Model Identifier

TTHERM_00047550

Standard Name

RPA1 (RNA Polymerase I largest subunit)

Aliases

PreTt11234 | 3.m01913 | RPII | 3824.m02992

Description

RPA1 DNA-directed RNA polymerase I protein; shared largest subunit of RNA Polymerase I

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_9278 0
Description: None
WormBase WBGene00012999 9.997093137033517e-262
Description: locus:rpoa-1 DNA-directed RNA polymerase status:Partially_confirmed UniProt:G5ED21 protein_id:CAB07687.2
Tetrahymena borealis EI9_01697.1 9.997093137033517e-262
Description: RNA polymerase Rpb1, domain 2 family protein (1722 aa)
DictyBase DDB_G0275759 9.997093137033517e-262
Description: rpa1 on chromosome: 2 position 5808489 to 5813651
Oxytricha Contig17704.0.g32 9.997093137033517e-262
Description: RNA polymerase Rpb1, domain 5
SGD YOR341W 9.997093137033517e-262
Description: RPA190 RNA polymerase I largest subunit A190

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15470252: Mochizuki K, Gorovsky MA (2004) RNA polymerase II localizes in Tetrahymena thermophila meiotic micronuclei when micronuclear transcription associated with genome rearrangement occurs. Eukaryotic cell 3(5):1233-40
  2. Ref:8756729: Shen X, Gorovsky MA (1996) Linker histone H1 regulates specific gene expression but not global transcription in vivo. Cell 86(3):475-83

Sequences

>TTHERM_00047550(coding)
ATGAATGCTCATTGTGTGCAAAATTAATTTAGAGTATAAAAAATAGAATCAAAAAAAGAA
GCAATAAAAGAAAGAAATAAATAAGATAAATTAAAAGATAAAAAATAAAAATAAAAGGAA
TTATTATTATATACTTATAGATATTAAATGAGTAATAGTTTAGGCTAATTCCAAGAGGTC
ATTAGTAGACGTCTCGCTGGTGTAGGCTTTTCTTATTACACTGCTGACGAAATCCGTAAA
TTGTCAGTAAAGGAAATAACTAATCCTATTGCATTCGACTCATTAAATAGACCTATCAAA
GGTGGTTTATATGATCCTTGTATGGGTGTATCTCCTTACGATAAATTTACTCGTTGCGAA
ACTTGTGGTTGTGAAGGATTGGAATGTCCTGGTCATATGGGTCACGTAGAACTCCTCTTA
CCTGTTTATAACCCTTTCTTAATTGATAAGTTGCTCAAGTTATTAAGAGCCTAGTGTTTA
AAATGCAATAAGTTTAGAATGACAAATTAAAAACTCAAGATGTTTGCTAATGTTTTTACT
CTTATTAAGCTTGGTTACATCTTCGAAGCTAAAGAATATAAATAAACATGTGAAAGTTTG
AGTATCCTTTAAATTTAAAATAATAAAGAAACAACTCAAATATAGTCATATGCTGACAAG
CGTCGTAAATCTAGTGATTACAAGTCATCTGACACTGAATAAATAATGCCTAAGAAGTCT
TAAATTGAATAGGAAGGAGCTAAGATTTATTAGAATAATATTAACAACCTTGAAGATAAA
AAGAAGCAATTGCTCTCTTTAATTAATGTTAAGCAAAATAATACAGAATAGTTTTCAAAG
GGTGTTTCTTACACAAATGCCATGAACAGTGCATTTGAATAAGCCCTCAAAGAATTTTGG
AATAGCATAAATATTGGCAAATGCCCTCACTGCAAAGAACCATAATAAGCAATTAGAAAA
GAAGGTTTTTCAAAGTTTTTCATAAAGAAAAGTTCTAGCGAAGCAAAGAAGTCTTCAAGC
CAAAAGAAACACTAAGATGACTACACTTCTGATGATGATCAAAGTGAGTCTGGTCACTCT
AAGGCTGAAAAAGCTAATGCTAATTAAAAATATCTTGATCCTTTAGAAGTAAAAGAATTA
ATGAGAAGATTTTGGGATGAAGAAAGAAAATTGCTTAACATCATTTACGGTACTATCGAA
GTTACTCCTTAAACTTTAAAAAACTCTTCTAAAGGTTTTATGATAAGAAGAAATGACTAT
AATATGTTCTTTATTGAAGTTATTCCAGTAACTCCCAATAGATTTAGACCTGAAAATAAG
CTTGGAGAATAAACATTCTTGCATGGACATACTGTAGTTTTGACAAAAATTTTATAATTC
AATGTTGAATTAAGACGTATGATTGTCTTGCAAAGACAAAGTTTAAGCGAAGAAAAGAAA
AAGAAATTAATAGATTAGCTTGATTCTCGCTTTTAAAATTAATTATAATTAAAGCAAAAC
TAGAATTTCTAGCAAACTATTAACAATATTGTTAAGCTTAATGATGTCATCACTAAGTGG
TTAGATATACAAGAAGCTGTTAACTGCTTTTTAGATTCTTCTAAGGCTACTAAGACTTAA
GATCGTGAAGGTACAGGTATTCGTTAACTCCTTGAAAAGAAGGAAGGTCTCTTTAGAATG
AAAATGATGGGTAAGCGTGTTAACTACGCAGCTAGATCAGTTATTTCTCCTGATCCTAAT
TTAAACACTAATGAAGTCGGTGTTCCACTTTTTGTTGCAAAAAAACTTACTTTCCCTGAA
TATGTAAATGAATATAATGCTAAGCATCTCAGAAAACTTATTATCAATGGTCCTTTCTAA
CATCCTGGTGCAAATTTCATTGTTGAAAACGGAAACAAGATTTCCCTTGAAGCTCTCAAT
GAGCAATAAAGAATAGGTCTTGCTAAGACTCTTTTAAATAACTCTAAAAATAAAGTTGTC
TATCGTCATTTATAATCTGGTGATGTCCTCCTTTTCAATAGACAACCTACCCTACATAAA
GCTTCATTGATGAGTCATATAGCTAGAGTACTTCCCAGAGAATAAACTATTAGAATGCAC
TATGCAAACTGTAAATCATATAATGCAGATTTCGATGGTGATGAAATGAACTTGCATTTC
CTTTAATCTCATTTAGCCAGAGCTGAAGGTTATCACATTAGTTTAAATGATCGTTAATTC
ATTAACACCACTAACGGTAATCCTTTGAGAGAATTGATTCAAGATACTATTGTTTCAGCT
GTATTCTTGACTCATAAGGAAAAATTCTTACAAAAAGAAGAATTCTAAGAGCTTGTCTAC
GCTGCTACTTGGAACATGTTTGAAAAGAATAATAATTCTACCACAAAGCCTTATAAGATT
TTCTTAGTTCCTCCTGCTATTCAAAAACCCAAACCTTTGTGGACTGGTAAACAACTCATC
ACAAACATCATCAAGATTGTAGTCTAATAGAATCAAAAGAAAGATTATGAATAAGGTGTC
TATATGGAAATGAAGGCAAAGCTTACTGCTGACGAATTGACTGGTATTTATAAGGACGAT
ACAGTTGTCATAATCAGAGATAATGAACTTCTTTAGGGTGTTTTGGATAAAAACTAATTT
GGTGCTGGTGCCACTTATGGTCTTATGCACGCTTTTTATGAATTATATGGAGCATCTCTA
ACAGGTAAGCTTTTCACTGCTCTTGCTAAATTACTCAGTGCCCATCTCTAAATGCATGGT
TTTACTTGCGGTATGGATGATCTTCTTGTCAGCAAAGAGAGTGATGAATAACGTCTTCAA
GAAATCAAGGCTGCACACGTTGATGGTGTCCTTGCATGTGCTGAATTCGTTGGTATGAAA
GACTATGAAGTTCCTTAAGGCTGGAATTTATATAACAGACCTAATTTTGTTCTCAACAGC
AAAGGTAGATTCTCTTCTAATGTTCTTAAACGTAAGCCCGAAGTTGACTATCTTTCAAAT
GAAAATCCCATTCTTGAGTAAATTCAAAGAAAGCTCGTTCGTGATCCCCAACTTGCTGAA
GCTTAAGATAATGTTTATAAGTCAACTATGTCTTAAAAAGGTTCCAAAATTCTTAACACT
GCTCTCGGTGGTCTTATTAAAAAATTCCCTTTCAACAATTTCACTACAATGACTAATTCT
GGTGCTAAGGGTTCTAAAGTCAACCATACGTAAGTTTCTGCCTTACTTGGTCAATAAGAA
TTAGAAGGTCGTAGAGTTCCCGTTATGGCTACTGGTCGTACTCTTCCTTGCTTCTTACCA
TATGATCCCAACCCAAGAGCTGGTGGTTTTATTAGTGATCGTTTCTTGAGTGGTCTTAGA
CCTGCTGAATTCTTCTTCCATTGTATGGCTGGTAGAGAAGGTTTGATTGATACTGCTGTC
AAAACAAGTAGATCCGGATATCTCCAAAGATGCTTAATGAAGCACTTAGAAGCACTTAAA
GTTGCATATGACTACACTGTCAGAGATGCTGATGGCTCAGTTGTCCAATTCTATTATGGT
GAAGACTCTATTGATCCCAATAAAGTTAAATATTTAGAAAAATTCCGTTTCTTAGCTGAA
AACTTTACTTCTTTCACTCAAAAATATGATCCTTATCACTTGAAAGACTCTCATGATTTC
GAATCTGTCAATCGTTTCTTGAAGAAAAGAAAGAGATAAGAAAGTTCTGAAACAGAAAAG
AAAACTTGTGACACTATTATGAACAACTTTTTACCTGGTAAACACATTGGCTCTGTTTCT
GAACGTGTCTACAAGAATGTAAAGGAATACATTAAGAAAGAATAGCAAAGTGCTGATCCT
TACAGCAACATCTTCAACATAAAGTAGGATTAATTAAGTCCTTAAAAATTCCATATGCTT
TTCAATGTAAAATACCTTAACTCTCTCATTCATCCTGGTGATTCTGTTGGTTGTCTTGCA
GCCCAAGCTATCGGTGAACCATCTACATAGATGACATTGAATACTTTCCACTTGGCTGGT
CACGGTGGTGTTAACCTTACCTTGGGTATTCCTCGTCTAAGAGAAATCTTGATGACTGCT
ACAGACAAATTGAAGACTCCAGTCATGCTTTTAAATCTTTCAAATCCTGAAGTTGCTTAA
AACAAAGAATAAGTTCAAAATCATGCTCGTAAGCTCTAAAAAATTAATTTATTAGAACTT
GTTAATAACATCGAAGTCAAGGAACAAAAAATTATTGTTGTTGATAACAATATTTTACCC
TTCAATGAACGTTTCAGACACTATGAAATTAAAATCAACTTAGAAGACTTAGAAGCTATT
CACTTCGCATTCTAATTAAACATTGACACAATTAATCGTAGAATTGAAAAGGTCTTCCTT
CCTAACCTCTTCTAATACATTAACAAAGAACTTAAACGTGATTAAAAATCTGAACTTTAA
ACTAGAGTTCTTAAGAAGAAAGAAAATGAAAGCAGCGGTATGGAAACTGAAGGCTTAGTT
AGCGATTTCGACAAAGAAGCTGCTTCAGATGGTGAAGAATTAAAGAAAGCTGCTGATGCT
TTAGTAAGCGAAGTAGAATATGGCATATTTACTGAGACAGAAGATGAATTAAAATCTAAG
TCCAAACCTCAATCTGCAGAACCAGTAAAGAGAGTCCCAACTAGAACTTCCAAAGCAGAA
TTATTTGAAGCTTCTCCTTATTACAACGGTCATACTATAGAAGGTGAACGTATAGTTTGT
AACATTAAATTACCTTTAGATTCTAAGAAGTTATTGATGGTCAACTTGGTTGAAAAAATA
TTAAAGAAGACTTTGGTTTATGAAGTAAAGAATATCTCTAATGCAACTGTCCTCAAAAAG
GATAATAAAGGAGCCACTTCTTATCAAATTTAAACAGAAGGTGTTAATTTCAAGTAAATC
TGGAAAATGGATCACTTCGACTCTAATACTATAGACTCAAATGATATAGCTGCCTTAAAC
AAATGTTACGGTATTGAAGCTGCTAGAAATGCAATTGTAAAAGAAATCGTCACTGTGTTC
GGTGTTTATGGTGTCGTTGTTGATTACAGACACTTGTACTTAATTGCTGATTATCTTACT
TTCAGCGGAGAAATGAAGGCCATGAATAGAGTTTGGATGGATGAAAGCATCAGTCCTTTC
CTCAAGATGTCTTTCGAAACTTGTGTTAAATTCCTTACAAATGCTGCTACAAATAATGAA
ATCGATACTCTTTCTACTCCTTCTTCCTCAATTGTCTTAGGTAGAGTTCCCTAAGTAGGT
ACTGGTGTTTTCGACATTCTCCATAAGGTTTGA


>TTHERM_00047550(gene)
ATGAATGCTCATTGTGTGCAAAATTAATTTAGAGTATAAAAAATAGAATCAAAAAAAGAA
GCAATAAAAGAAAGAAATAAATAAGATAAATTAAAAGATAAAAAATAAAAATAAAAGGAA
TTATTATTATATACTTATAGATATTAAATGAGTAATAGTTTAGGCTAATTCCAAGAGGTC
ATTAGTAGACGTCTCGCTGGTGTAGGCTTTTCTTATTACACTGCTGACGAAATCCGTAAA
TTGTCAGTAAAGGAAATAACTAATCCTATTGCATTCGACTCATTAAATAGACCTATCAAA
GGTAATAAATCGATTTTTCATAATTTATAAAATTCCTTTTCATGATTTCATAATGCTACT
TTGATTATTTAAAGATTGTAGTTATGGAATCTTTTAAAACTTTGATATTTTTTTTCCCAA
ATTTATTACAATACTCAAAGCATTATATAATGAAATATATTTTAATAAACAAAGGTGGTT
TATATGATCCTTGTATGGGTGTATCTCCTTACGATAAATTTACTCGTTGCGAAACTTGTG
GTTGTGAAGGATTGGAATGTCCTGGTATAAATTTATTAATAAATTTTGATTTATCCATTG
AATTTCATGAAGCTGATATCTTGCATTTTTGGTTAATCATTAAGTTGATAAGCATTAAGA
AAAATTTACGGATTTCATGAATTTTCAATATAACTTTGAAAAATTTTACTCAATCGTTTT
ATTTCTACATTAAATAAAATAGGTCATATGGGTCACGTAGAACTCCTCTTACCTGTTTAT
AACCCTTTCTTAATTGATAAGTTGCTCAAGTTATTAAGGTATACCTCTATTCAATAAAAT
AAATTAAATATAAGAAACAAAACATTTTAGCTCGATCTTGTAAATCTTTAAATCAAAAAA
TAAAGAAGTTTTAAGCCAACAAAATAATTAAACAGAGTTTTAAAAAATTTAAAAGCTAAA
TAAGAGGATTAGTTAGTTAGTTACAAATAAACATTCAATATAATAGCAATCTTAACATAT
ATTAGACTAATAAATTTAACATTTTAAAAGTATATTTATTAGTCTACTTATTAAACATAA
AAATGTTTAGATACATTGTTACAAATTACTATTTAAGAAATAAAAAGATTTCAATAAATA
GATTAGAGCATAAATTTGTCTATTTTTGCATTATTTCTAAAACAAGTAATTAAAATAATT
ATAAATTTATTTAAATAGAGCCTAGTGTTTAAAATGCAATAAGTTTAGAATGACAAATTA
AAAACTCAAGATGTTTGCTAATGTTTTTACTCTTATTAAGCTTGGTTACATCTTCGAAGC
TAAAGAATATAAATAAACATGTGAAAGTTTGAGTATCCTTTAAATTTAAAATAATAAAGA
AACAACTCAAATATAGTCATATGCTGACAAGCGTCGTAAATCTAGTGATTACAAGTCATC
TGACACTGAATAAATAATGCCTAAGAAGTCTTAAATTGAATAGGAAGGAGCTAAGATTTA
TTAGAATAATATTAACAACCTTGAAGATAAAAAGAAGCAATTGCTCTCTTTAATTAATGT
TAAGCAAAATAATACAGAATAGTTTTCAAAGGGTGTTTCTTACACAAATGCCATGAACAG
TGCATTTGAATAAGCCCTCAAAGAATTTTGGAATAGCATAAATATTGGCAAATGCCCTCA
CTGCAAAGAACCATAATAAGCAATTAGAAAAGAAGGTTTTTCAAAGTTTTTCATAAAGAA
AAGTTCTAGCGAAGCAAAGAAGTCTTCAAGCCAAAAGAAACACTAAGATGACTACACTTC
TGATGATGATCAAAGTGAGTCTGGTCACTCTAAGGCTGAAAAAGCTAATGCTAATTAAAA
ATATCTTGATCCTTTAGAAGTAAAAGAATTAATGAGAAGATTTTGGGATGAAGAAAGAAA
ATTGCTTAACATCATTTACGGTACTATCGAAGTTACTCCTTAAACTTTAAAAAACTCTTC
TAAAGGTATTTATTTATTTGTTAATATATTTTTTTTCTAGAAAATAATAACTAATTTATT
TTAATTTAATAGGTTTTATGATAAGAAGAAATGACTATAATATGTTCTTTATTGAAGTTA
TTCCAGTAACTCCCAATAGATTTAGACCTGAAAATAAGCTTGGAGAATAAACATTCTTGC
ATGGACATACTGTAGTTTTGACAAAAATTTTATAATTCAATGTTGAATTAAGACGTATGA
TTGTCTTGCAAAGACAAAGTTTAAGCGAAGAAAAGAAAAAGAAATTAATAGATTAGCTTG
ATTCTCGCTTTTAAAATTAATTATAATTAAAGCAAAACTAGAATTTCTAGCAAACTATTA
ACAATATTGTTAAGCTTAATGATGTCATCACTAAGTGGTTAGATATACAAGAAGCTGTTA
ACTGCTTTTTAGATTCTTCTAAGGCTACTAAGACTTAAGATCGTGAAGGTACAGGTATTC
GTTAACTCCTTGAAAAGAAGGAAGGTCTCTTTAGAATGAAAATGATGGGTAAGCGTGTTA
ACTACGCAGCTAGATCAGTTATTTCTCCTGATCCTAATTTAAACACTAATGAAGTCGGTG
TTCCACTTTTTGTTGCAAAAAAACTTACTTTCCCTGAATATGTAAATGAATATAATGCTA
AGCATCTCAGAAAACTTATTATCAATGGTCCTTTCTAACATCCTGGTGCAAATTTCATTG
TTGAAAACGGAAACAAGATTTCCCTTGAAGCTCTCAATGAGCAATAAAGAATAGGTCTTG
CTAAGACTCTTTTAAATAACTCTAAAAATAAAGTTGTCTATCGTCATTTATAATCTGGTG
ATGTCCTCCTTTTCAATAGACAAGTAATTTTTAACAAATTTATTTTTTAACTCAAACTTT
TACTTTTGTTGTTGTTTTTTTTTTAAGAGTAAGCTTATTTTATTTTTAAACTATAATAGC
CTACCCTACATAAAGCTTCATTGATGAGTCATATAGCTAGAGTACTTCCCAGAGAATAAA
CTATTAGAATGCACTATGCAAACTGTAAATCATATAATGCAGATTTCGATGGTGATGAAA
TGAACTTGCATTTCCTTTAATCTCATTTAGCCAGAGCTGAAGGTTATCACATTAGTTTAA
ATGATCGTTAATTCATTAACACCACTAACGGTAATCCTTTGAGAGAATTGATTCAAGATA
CTATTGTTTCAGCTGTATTCTTGACTCATAAGGAAAAATTCTTACAAAAAGAAGAATTCT
AAGAGCTTGTCTACGCTGCTACTTGGAACATGTTTGAAAAGAATAATAATTCTACCACAA
AGCCTTATAAGATTTTCTTAGTTCCTCCTGCTATTCAAAAACCCAAACCTTTGTGGACTG
GTAAACAACTCATCACAAACATCATCAAGATTGTAGTCTAATAGAATCAAAAGAAAGATT
ATGAATAAGGTGTCTATATGGAAATGAAGGCAAAGCTTACTGCTGACGAATTGACTGGTA
TTTATAAGGACGATACAGTTGTCATAATCAGAGATAATGAACTTCTTTAGGGTGTTTTGG
ATAAAAACTAATTTGGTGCTGGTGCCACTTATGGTCTTATGCACGCTTTTTATGAATTAT
ATGGAGCATCTCTAACAGGTAAGCTTTTCACTGCTCTTGCTAAATTACTCAGTGCCCATC
TCTAAATGCATGGTTTTACTTGCGGTATGGATGATCTTCTTGTCAGCAAAGAGAGTGATG
AATAACGTCTTCAAGAAATCAAGGCTGCACACGTTGATGGTGTCCTTGCATGTGCTGAAT
TCGTTGGTATGAAAGACTATGAAGTTCCTTAAGGCTGGAATTTATATAACAGACCTAATT
TTGTTCTCAACAGCAAAGGTAGATTCTCTTCTAATGTTCTTAAACGTAAGCCCGAAGTTG
ACTATCTTTCAAATGAAAATCCCATTCTTGAGTAAATTCAAAGAAAGCTCGTTCGTGATC
CCCAACTTGCTGAAGCTTAAGATAATGTTTATAAGTCAACTATGTCTTAAAAAGGTTCCA
AAATTCTTAACACTGCTCTCGGTGGTCTTATTAAAAAATTCCCTTTCAACAATTTCACTA
CAATGACTAATTCTGGTGCTAAGGGTTCTAAAGTCAACCATACGTAAGTTTCTGCCTTAC
TTGGTCAATAAGAATTAGAAGGTCGTAGAGTTCCCGTTATGGCTACTGGTCGTACTCTTC
CTTGCTTCTTACCATATGATCCCAACCCAAGAGCTGGTAATAAAAAAATTTATTTACTTG
TTTTATTAATTTAATTAAATATATATTAAAATAAATAGGTGGTTTTATTAGTGATCGTTT
CTTGAGTGGTCTTAGACCTGCTGAATTCTTCTTCCATTGTATGGCTGGTAGAGAAGGTTT
GATTGATACTGCTGTCAAAACAAGTAGATCCGGATATCTCCAAAGATGCTTAATGAAGCA
CTTAGAAGCACTTAAAGTTGCATATGACTACACTGTCAGAGATGCTGATGGCTCAGTTGT
CCAATTCTATTATGGTGAAGACTCTATTGATCCCAATAAAGTTAAATATTTAGAAAAATT
CCGTTTCTTAGCTGAAAACTTTACTTCTTTCACTCAAAAATATGATCCTTATCACTTGAA
AGACTCTCATGATTTCGAATCTGTCAATCGTTTCTTGAAGAAAAGAAAGAGATAAGAAAG
TTCTGAAACAGAAAAGAAAACTTGTGACACTATTATGAACAACTTTTTACCTGGTAAACA
CATTGGCTCTGTTTCTGAACGTGTCTACAAGAATGTAAAGGAATACATTAAGAAAGAATA
GCAAAGTGCTGATCCTTACAGCAACATCTTCAACATAAAGTAGGATTAATTAAGTCCTTA
AAAATTCCATATGCTTTTCAATGTAAAATACCTTAACTCTCTCATTCATCCTGGTGATTC
TGTTGGTTGTCTTGCAGCCCAAGCTATCGGTGAACCATCTACATAGATGACATTGAATAC
TTTCCACTTGGCTGGTCACGGTGGTGTTAACCTTACCTTGGGTATTCCTCGTCTAAGAGA
AATCTTGATGACTGCTACAGACAAATTGAAGACTCCAGTCATGCTTTTAAATCTTTCAAA
TCCTGAAGTTGCTTAAAACAAAGAATAAGTTCAAAATCATGCTCGTAAGCTCTAAAAAAT
TAATTTATTAGAACTTGTTAATAACATCGAAGTCAAGGAACAAAAAATTATTGTTGTTGA
TAACAATATTTTACCCTTCAATGAACGTTTCAGACACTATGAAATTAAAATCAACTTAGA
AGACTTAGAAGCTATTCACTTCGCATTCTAATTAAACATTGACACAATTAATCGTAGAAT
TGAAAAGGTCTTCCTTCCTAACCTCTTCTAATACATTAACAAAGAACTTAAACGTGATTA
AAAATCTGAACTTTAAACTAGAGTTCTTAAGAAGAAAGAAAATGAAAGTAAAATTATTTT
AAATAAATTATTTAAAAATATTAACCTAATTATAATTTAAAAAGGCAGCGGTATGGAAAC
TGAAGGCTTAGTTAGCGATTTCGACAAAGAAGCTGCTTCAGATGGTGAAGAATTAAAGAA
AGCTGCTGATGCTTTAGTAAGCGAAGTAGAATATGGCATATTTACTGAGACAGAAGATGA
ATTAAAATCTAAGTCCAAACCTCAATCTGCAGAACCAGTAAAGAGAGTCCCAACTAGAAC
TTCCAAAGCAGAATTATTTGAAGCTTCTCCTTATTACAACGTAAGCTATTAATAAATATT
CAAAACCATAAGTAATATCTATATATTAATCAAAAAGGGTCATACTATAGAAGGTGAACG
TATAGTTTGTAACATTAAATTACCTTTAGATTCTAAGAAGTTATTGATGGTCAAGTAATA
ATTCTTTACTATTTTTTATTTATTTGTGCTTTCTTCAATTTTAAAAAAACACTTATTAAT
TCTCATTTTACATAAAATAGCTTGGTTGAAAAAATATTAAAGAAGACTTTGGTTTATGAA
GTAAAGAATATCTCTAATGCAACTGTCCTCAAAAAGGATAATAAAGGAGCCACTTCTTAT
CAAATTTAAACAGAAGGTGTTAATTTCAAGTAAATCTGGAAAATGGATCACTTCGACTCT
AATACTATAGACTCAAATGATATAGCTGCCTTAAACAAATGTTACGGTGTAAGAAATTCA
TTTTTTTTAACAAAAAAATATTTTATTTTGATTATTTACATATTAATTATATTTTAATAA
TTAGATTGAAGCTGCTAGAAATGCAATTGTAAAAGAAATCGTCACTGTGTTCGGTGTTTA
TGGTGTCGTTGTTGATTACAGACACTTGTACTTAATTGCTGATTATCTTACTTTCAGCGG
AGAAATGAAGGCCATGAATAGAGTTTGGATGGATGAAAGCATCAGTCCTTTCCTCAAGAT
GTCTTTCGAAACTTGTGTTAAATTCCTTACAAATGCTGCTACAAATAATGAAATCGATAC
TCTTTCTACTCCTTCTTCCTCAATTGTCTTAGGTAGAGTTCCCTAAGTAGGTACTGGTGT
TTTCGACATTCTCCATAAGGTTTGA


>TTHERM_00047550(protein)
MNAHCVQNQFRVQKIESKKEAIKERNKQDKLKDKKQKQKELLLYTYRYQMSNSLGQFQEV
ISRRLAGVGFSYYTADEIRKLSVKEITNPIAFDSLNRPIKGGLYDPCMGVSPYDKFTRCE
TCGCEGLECPGHMGHVELLLPVYNPFLIDKLLKLLRAQCLKCNKFRMTNQKLKMFANVFT
LIKLGYIFEAKEYKQTCESLSILQIQNNKETTQIQSYADKRRKSSDYKSSDTEQIMPKKS
QIEQEGAKIYQNNINNLEDKKKQLLSLINVKQNNTEQFSKGVSYTNAMNSAFEQALKEFW
NSINIGKCPHCKEPQQAIRKEGFSKFFIKKSSSEAKKSSSQKKHQDDYTSDDDQSESGHS
KAEKANANQKYLDPLEVKELMRRFWDEERKLLNIIYGTIEVTPQTLKNSSKGFMIRRNDY
NMFFIEVIPVTPNRFRPENKLGEQTFLHGHTVVLTKILQFNVELRRMIVLQRQSLSEEKK
KKLIDQLDSRFQNQLQLKQNQNFQQTINNIVKLNDVITKWLDIQEAVNCFLDSSKATKTQ
DREGTGIRQLLEKKEGLFRMKMMGKRVNYAARSVISPDPNLNTNEVGVPLFVAKKLTFPE
YVNEYNAKHLRKLIINGPFQHPGANFIVENGNKISLEALNEQQRIGLAKTLLNNSKNKVV
YRHLQSGDVLLFNRQPTLHKASLMSHIARVLPREQTIRMHYANCKSYNADFDGDEMNLHF
LQSHLARAEGYHISLNDRQFINTTNGNPLRELIQDTIVSAVFLTHKEKFLQKEEFQELVY
AATWNMFEKNNNSTTKPYKIFLVPPAIQKPKPLWTGKQLITNIIKIVVQQNQKKDYEQGV
YMEMKAKLTADELTGIYKDDTVVIIRDNELLQGVLDKNQFGAGATYGLMHAFYELYGASL
TGKLFTALAKLLSAHLQMHGFTCGMDDLLVSKESDEQRLQEIKAAHVDGVLACAEFVGMK
DYEVPQGWNLYNRPNFVLNSKGRFSSNVLKRKPEVDYLSNENPILEQIQRKLVRDPQLAE
AQDNVYKSTMSQKGSKILNTALGGLIKKFPFNNFTTMTNSGAKGSKVNHTQVSALLGQQE
LEGRRVPVMATGRTLPCFLPYDPNPRAGGFISDRFLSGLRPAEFFFHCMAGREGLIDTAV
KTSRSGYLQRCLMKHLEALKVAYDYTVRDADGSVVQFYYGEDSIDPNKVKYLEKFRFLAE
NFTSFTQKYDPYHLKDSHDFESVNRFLKKRKRQESSETEKKTCDTIMNNFLPGKHIGSVS
ERVYKNVKEYIKKEQQSADPYSNIFNIKQDQLSPQKFHMLFNVKYLNSLIHPGDSVGCLA
AQAIGEPSTQMTLNTFHLAGHGGVNLTLGIPRLREILMTATDKLKTPVMLLNLSNPEVAQ
NKEQVQNHARKLQKINLLELVNNIEVKEQKIIVVDNNILPFNERFRHYEIKINLEDLEAI
HFAFQLNIDTINRRIEKVFLPNLFQYINKELKRDQKSELQTRVLKKKENESSGMETEGLV
SDFDKEAASDGEELKKAADALVSEVEYGIFTETEDELKSKSKPQSAEPVKRVPTRTSKAE
LFEASPYYNGHTIEGERIVCNIKLPLDSKKLLMVNLVEKILKKTLVYEVKNISNATVLKK
DNKGATSYQIQTEGVNFKQIWKMDHFDSNTIDSNDIAALNKCYGIEAARNAIVKEIVTVF
GVYGVVVDYRHLYLIADYLTFSGEMKAMNRVWMDESISPFLKMSFETCVKFLTNAATNNE
IDTLSTPSSSIVLGRVPQVGTGVFDILHKV