Identifiers and Description

Gene Model Identifier

TTHERM_00049420

Standard Name

CYC32 (CYClin 32)

Aliases

PreTt11321 | 3.m01909 | 3824.m03079

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01619.1 3.0005855096961235e-80
Description: hypothetical protein (243 aa)
DictyBase DDB_G0280425 0.000000000000001999258566166494
Description: DDB_G0280425 on chromosome: 3 position 3332494 to 3333718
Oxytricha Contig20637.0.g110 0.000000000040005666873964816
Description: Cyclin
SGD YOL001W 0.00000000009998509410508463
Description: PHO80 Cyclin, interacts with cyclin-dependent kinase Pho85p; regulates the response to nutrient levels and environmental conditions, including the response to phosphate limitation and stress-dependent calcium signaling

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00049420(coding)
ATGAGCACTTAGGGTTCTTTTTCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAA
AATAAAGAAGCTGGTGCTGAACAAGAATTGCAATGTTCTGCTGAAGACAATCAAGAAATC
TTTCTTTGGACATAAAAAGTCTCTCATATTTTGCAAGAAATTATTAAAGTCTAGCAAATC
TTGGATAAAAACAAACTCAGAAGCTTCCAAAATAGTTGTTTTAACAACAGCTGCATTCCT
TAAGTTTCACTTAGCGACTACATGTACAAAATCATGACTGAAGCTAGACTTGAAATTGAT
ATTTGCATAATCAGTCTATTCTACATTGATAGATTAACTTCTTGTCAGCCTAATTTCAGA
ATTAACTAATTCAATTGCCACAGATTAATTTTGACTTCTATGATGGTTGCTTCCAAGATG
CACTAAGACATACAAAGCTACTTCTAAGTTGTCAAGCTCTTTTCATTAATCGGAGGTGTA
TGTGAGAAAGAACTCTACTTGATGGAGTAGACATTATTAGATCTCCTTAATTACCAATTA
TTCATCTCAGAAGATGACTACACCAGATACAAAAACTAACTCACTTGTTTCTAGCTTTGA


>TTHERM_00049420(gene)
ATGAGCACTTAGGGTTCTTTTTCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAA
AATAAAGAAGCTGGTGTAAGAATTTGTTAAAAAATATTCATTTTTTATTTAAATAGACCT
TTTAATTTATACATTAGATTTGGATTGTTTTTAGTGTTTAATAAATAAATAAATTATTAA
ATTCAGTTCAAAAGTGTAAAATCACAACAATAATTTATCACTTTATTTGCTTTTTATTTA
TTGAAAATGCATGTTTTCTATGTTAAAAATACTCATTTGAGATCTAATTCTAAATTATCC
AAATTAGGCTGAACAAGAATTGCAATGTTCTGCTGAAGACAATCAAGAAATCTTTCTTTG
GACATAAAAAGTCTCTCATATTTTGCAAGAAATTATTAAAGTCTAGCAAATCTTGGATAA
AAACAAACTCAGAAGCTTCCAAAATAGTTGTTTTAACAACAGCTGCATTCCTTAAGTTTC
ACTTAGCGACTACATGTACAAAATCATGACTGAAGCTAGACTTGAAATTGATATTTGCAT
AATCAGTCTATTCTACATTGATAGATTAACTTCTTGTCAGCCTAATTTCAGAATTAACTA
ATTCAATTGCCACAGGTAATTAGTTTCTACTTTTTTTTATGGTTTTTTAACTTTTTTGCA
GGGCTATAATCACGTTAGTATTAATCCTTTTGAATTTATTAAAATTCTACTCGCCTTTAG
CATAAAATGTCACATAAATTTTGCTTATTTTACTAAGAAGTAAAGGCGTTGAAATAATAT
CTGTGTTTTCTCTACCTCTTTCTTTTTAAATTGCAAAAGATGATAAGATAATGAAAAAAA
AGAAAAAAAAAATAATATAAGGGCGCACACATAATTTTTTTTTTTAATTAATCAAATTCT
GTCTTTAGTATCCCCACCCTAACTTAAATAAGCTTATCTAGAAAAAGGTTGTATTAAAAA
CTAGAATGAAATATTCACAATTCATGATAAATTTTAAATATTTGATCAAAAAAAGTTATA
CTGGTATTACTCATACCAGCAATTTTAAAAGAGCGTAAAATACATACTGACATATTAAGA
TAAGAATATTTTGCATTTTATTTAAGTTTTCCTTTTTTTTATTATTCTTTATCAATCATT
CTACTTATTTATCTATAAATTTTACAAATCGGATTCAATTTTATCATGAATAAAATTAAT
AAGCGATTTACATAAAATTTCATTTGTTTCTTCAAATCAAGTAAACATGCCCACCCTACT
TTGAGTACTAGAAAAGAAAAAAAAAATAGAAATTAAAATTTTAGCTGAACTCATTAGCTA
CAATGAAAAAAGATAGAGCTTTCTTTATTTTTTAAAGAGATTGCTTTATGTAATTTTAAG
TAAATAAGAGAAGAGGAAAGGAAAATTTAATTTAATTATAATTTAATTGGTCCCCCACCA
TGTTATTTATTATAATTATTATTCATCATTCTAAAGCCTAAAAATTTAAGCTTTTACGTA
CTTATATTATTAATCGAATGCCACAAAGTCATATGGCTTAAATTATCCACTGACATTAAA
TAAATAAGCTATAGATTGATCGATAGAAATAGCAAGATTAGCAAATAAATGAGTAGCATA
TAAATAAATGTCTGCCATAATTAATTTATTTTTCTATCTTAAATGTGTCTATCCTGATAT
CAAATTTACTAGAATTATCAAATATATATATATGCCCAATAAAATTTAAACCCAAATCAG
TTTAACTGAAAATTTAATTGATTTCAATTTAAAAATAAATAGATTAATTTTGACTTCTAT
GATGGTTGCTTCCAAGATGCACTAAGACATACAAAGCTACTTCTAAGTTGTCAAGCTCTT
TTCATTAATCGGAGGTGTATGTGAGAAAGAACTCTACTTGATGGAGTAGACATTATTAGA
TCTCCTTAATTACCAATTATTCATCTCAGAAGATGACTACACCAGATACAAAAACTAACT
CACTTGTTTCTAGCTTTGA


>TTHERM_00049420(protein)
MSTQGSFSQNCSEFYSPATENKEAGAEQELQCSAEDNQEIFLWTQKVSHILQEIIKVQQI
LDKNKLRSFQNSCFNNSCIPQVSLSDYMYKIMTEARLEIDICIISLFYIDRLTSCQPNFR
INQFNCHRLILTSMMVASKMHQDIQSYFQVVKLFSLIGGVCEKELYLMEQTLLDLLNYQL
FISEDDYTRYKNQLTCFQL