Identifiers and Description

Gene Model Identifier

TTHERM_00051720

Standard Name

KHD1 (KH domain-containing protein 1)

Aliases

PreTt11353 | 3.m01791 | 3824.m03106

Description

KHD1 KH domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01596.1 9.997093137033517e-262
Description: KH domain-containing protein (694 aa)
Oxytricha Contig17537.0.g93 7.002264059090237e-38
Description: KH domain
WormBase WBGene00022738 0.00000000000040012475857291343
Description: status:Confirmed UniProt:Q7Z145 protein_id:CCD61630.1
SGD YLR116W 0.000000000006001570085597868
Description: MSL5 Component of the commitment complex, which defines the first step in the splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00051720(coding)
ATGAGACATTCGTCATCTAAATCTAGATCAAGATCAAAGGGTAACAAACGCGGTGGATAA
AAAAGATCTTCACAAGATAGAGGATCTTATAAAAGAAGCTTCAGTAGATCTGATAGCAGA
GGAAAAGATTCAAAAAGAGGGGGAGGAGATTTCAATTCTAGAAGACGCAACAAATTTTCA
GATCCTTCATAGAATGGTGGAAGTAGCTAAAGAGGTGGCTTTAGCAGTGGTTTCAATGAT
TCAAATAGTAATTAGAGAAACGATGATAGAGGTTATCAGAGTGGAAATGGAGGATTTGGA
TCTAAAGGAGGATAATAGTATGGATCTAGAAACGATAATGGATACAAAGGAGATTAGAAT
GGAAATGGAGGCTTTTCTTACAACAATGTCAGGAATTCTTAAGGACCTAATATGAATGAA
GACATAGACAGAATTTTACAGAATTCAAAACCTGAATCTTCATACAACCGTAACTAATAT
GATAGATCTTCAAATGGAGTAGGCTTTAACAATAATTTTTCAGGAAATTCAGGATAAGGA
AGTAGTTACGATAACTACCAGATATCTACTTCTTCATTAAGATAATCTTCTTCAAAAACT
TTCCGCAAAGTCCCTATTCCTTAAGATGGGAAATTTAATTATATTGGACTAATTATTGGC
CCAAAGGGTTCTAAACAAAAGTAATTAGAAGAAATGACTCATTGTAAAATTTTAATCAGG
GGAAAGGGCTCTCAAAAATAAGGTGCACCTTAATAGCCTGATGATAATGAAGACTTACAT
GTTTTAATTGAGGCAGATTCTGAAATGAATGCAAACAAAGCCATGAAAGAAATCGAAAAT
ATCATTTTTATGGATGATGACTAAAAAGTTAAGCTCCGTGATTAGTAACTTAAGTCTAAT
TACAATGGTGGCTAGTAACATAGACCAGATGGTTAATATAACAATAATAATGACAGATAG
ACTTTCATTTAAATTCCAAAAGATGTTGTAGGACTTGTGATTGGAAAGAAAGGTGAAACA
ATCAAATAAATCAAAGAAAAGTCAGGTGCTGATAAAGTTTACATGCAACCTGAAAATTAA
CGCAATTAATAAGATGATTCCTATTAAAATCTTATTGTAGAAGGCTCTGCAAGCTAAGTT
GAAAGAGTTAGAGAGCTAGTCAATGACATTAAAAACTAATAGCAACAAAAGAAATAAGGG
TACAACGATAATTTTAATAACAACAATTTCAATAATAGAGGTGGTAATTAAAAGCAAGAA
GCTAGAATAGAAATGGAAATACCAGCAAATTTGGCTGGTTTAGTCATTGGATCTAAAGGC
TCTACCTTGCAATAAGTGGGTAGTGAAACAAGGACACGTTGTTAAATTAATTAAAACAAT
AATGACAACAGAAAAATATTAATAATTGTTGGTAATACAGAAGAGGATTGCCAAAGAGCT
AAAGAAATATTCTAAGAAAAAATGAACAGCAGAATGGCAGGAAACTAAAATGACAGAGAC
AATAACTAAAGAGGAGGTGGTTTCAATAATAGAGGGAATAATAATAGTAGTAGAGGAGGA
GGCAGAACCTTTAATAACCGTCGTCCTCGTAAGAATGCTGATGATGATGAAATTGTAGAA
GCATATTAGTTTGAATCATATCCTACTTACAATCTTGAAGAATAAATGATGCATAGCTAG
TAAATGTTGCTTAACATGCAAAATTTCTACAATCAATAGGGTTAATATCCTCCTTAGTAA
TAAGTTCCACCTGCATACGGCAATCAGCAATAATAGTAACCCAGTGATTCATATGCTGTA
GATTCCAAACCTGGTTAGTCAACTGATAATTTAACTAACACTAATATTTCTACTTCAGAA
AATAACACCGTAAATTCTATTTCACCTCAACCCCAATAATAAGCTGCAACTACAGAATTT
TAGCAGTATCCATAACCATATGGTTAAGCACCAGGCTATGATCCAAACTAAGTGTAAATG
TAAATCTCATAATATCTTTAATATTAGCAAATGTACTTGCAAACACAAAGCTACACAGGA
CCTGTTATTGAAGAAGTACTAGCTGACGGAACCATAGTTTCTCTAAGTTAAAATGCAGAT
GACAAAAAGAAAGGTAAGAGAGGAGGTAGAAGATGA


>TTHERM_00051720(gene)
ATGAGACATTCGTCATCTAAATCTAGATCAAGATCAAAGGGTAACAAACGCGGTGGATAA
AAAAGATCTTCACAAGATAGAGGATCTTATAAAAGAAGCTTCAGTAGATCTGATAGCAGA
GGAAAAGATTCAAAAAGAGGGGGAGGAGATTTCAATTCTAGAAGACGCAACAAATTTTCA
GATCCTTCATAGAATGGTGGAAGTAGCTAAAGAGGTGGCTTTAGCAGTGGTTTCAATGAT
TCAAATAGTAATTAGAGAAACGATGATAGAGGTTATCAGAGTGGAAATGGAGGATTTGGA
TCTAAAGGAGGATAATAGTATGGATCTAGAAACGATAATGGATACAAAGGAGATTAGAAT
GGAAATGGAGGCTTTTCTTACAACAATGTCAGGAATTCTTAAGGACCTAATATGAATGAA
GACATAGACAGAATTTTACAGAATTCAAAACCTGAATCTTCATACAACCGTAACTAATAT
GATAGATCTTCAAATGGAGTAGGCTTTAACAATAATTTTTCAGGAAATTCAGGATAAGGA
AGTAGTTACGATAACTACCAGATATCTACTTCTTCATTAAGATAATCTTCTTCAAAAACT
TTCCGCAAAGTCCCTATTCCTTAAGATGGGAAATTTAATTATATTGGACTAATTATTGGC
CCAAAGGGTTCTAAACAAAAGTAATTAGAAGAAATGACTCATTGTAAAATTTTAATCAGG
TAAATTTCCAAAAAATAAATACTGCTTTTAAATTATGTCTGTATGAATAATTATAAAAGC
AAATTTCGCCCATTATTTCATAAATATTTATTTACTTTTTTATGATTTTTTCTCATTATT
TTGCTTTTCGAATTTACATTGAGCTGGGTATATCTACTTAACCTGACTGATGTCTATCAA
TTAATTAATTATTTAATTAATTAGTTGCCAAATCAATTATAATTATTTAATTTTCCCTAA
ATCACTTTTTTTTATAATAATAATTATAATAATATTCAAATTTTAATTAAAGTAACTCAA
TTTTTTTTGCTTTCAAAAAATTAAATAAATAAATGATTAATTAACAAATAATTATTATAT
ATATCTTAATCATTTAAATACTTAATAATAGGGGAAAGGGCTCTCAAAAATAAGGTGCAC
CTTAATAGCCTGATGATAATGAAGACTTACATGTTTTAATTGAGGCAGATTCTGAAATGA
ATGCAAACAAAGCCATGAAAGAAATCGAAAATATCATTTTTATGGATGATGACTAAAAAG
TTAAGCTCCGTGATTAGTAACTTAAGTCTAATTACAATGGTGGCTAGTAACATAGACCAG
ATGGTTAATATAACAATAATAATGACAGATAGACTTTCATTTAAATTCCAAAAGATGTTG
TAGGACTTGTGATTGGTAAAAACATTTTCTTTTATTTTTTCATTTTTTACAATGTTTATT
AATTTATTAATAGGAAAGAAAGGTGAAACAATCAAATAAATCAAAGAAAAGTCAGGTGCT
GATAAAGTTTACATGCAACCTGAAAATTAACGCAATTAATAAGATGATTCCTATTAAAAT
CTTATTGTAGAAGGCTCTGCAAGCTAAGTTGAAAGAGTTAGAGAGCTAGTCAATGACATT
AAAAACTAATAGCAACAAAAGAAATAAGGGTACAACGATAATTTTAATAACAACAATTTC
AATAATAGAGGTGGTAATTAAAAGCAAGAAGCTAGAATAGAAATGGAAATACCAGCAAAT
TTGGCTGGTTTAGTCATTGGATCTAAAGGCTCTACCTTGCAATAAGTGGGTAGTGAAACA
AGGACACGTTGTTAAATTAATTAAAACAATAATGACAACAGAAAAATATTAATAATTGTT
GGTAATACAGAAGAGGATTGCCAAAGAGCTAAAGAAATATTCTAAGAAAAAATGAACAGC
AGAATGGCAGGAAACTAAAATGACAGAGACAATAACTAAAGAGGAGGTGGTTTCAATAAT
AGAGGGAATAATAATAGTAGTAGAGGAGGAGGCAGAACCTTTAATAACCGTCGTCCTCGT
AAGAATGCTGATGATGATGAAATTGTAGAAGCATATTAGTTTGAATCATATCCTACTTAC
AATCTTGAAGAATAAATGATGCATAGCTAGTAAATGTTGCTTAACATGCAAAATTTCTAC
AATCAATAGGGTTAATATCCTCCTTAGTAATAAGTTCCACCTGCATACGGCAATCAGCAA
TAATAGTAACCCAGTGATTCATATGCTGTAGATTCCAAACCTGGTTAGTCAACTGATAAT
TTAACTAACACTAATATTTCTACTTCAGAAAATAACACCGTAAATTCTATTTCACCTCAA
CCCCAATAATAAGCTGCAACTACAGAATTTTAGCAGTATCCATAACCATATGGTTAAGCA
CCAGGCTATGATCCAAACTAAGTGTAAATGTAAATCTCATAATATCTTTAATATTAGCAA
ATGTACTTGCAAACACAAAGCTACACAGGACCTGTTATTGAAGAAGTACTAGCTGACGGA
ACCATAGTTTCTCTAAGTTAAAGTAATTAATTATTCAATTCAGGTTATTATCAAAATAAA
AAATAAAAATTTGATAAAAAGCTTAATTTTTGCTAACCTAATTATAAAGTAAATAAAAAG
AAGCAAAGTTAGTAAAATATAAACTGGATTTATTAATTTTGTTTACAGAAATTATTAACA
GCTAAATAAATTTATGAATATTTAAAATTAAATTAAATTAAAAATTTTATTTTAATTAAA
ATAGATGCAGATGACAAAAAGAAAGGTAAGAGAGGAGGTAGAAGATGA


>TTHERM_00051720(protein)
MRHSSSKSRSRSKGNKRGGQKRSSQDRGSYKRSFSRSDSRGKDSKRGGGDFNSRRRNKFS
DPSQNGGSSQRGGFSSGFNDSNSNQRNDDRGYQSGNGGFGSKGGQQYGSRNDNGYKGDQN
GNGGFSYNNVRNSQGPNMNEDIDRILQNSKPESSYNRNQYDRSSNGVGFNNNFSGNSGQG
SSYDNYQISTSSLRQSSSKTFRKVPIPQDGKFNYIGLIIGPKGSKQKQLEEMTHCKILIR
GKGSQKQGAPQQPDDNEDLHVLIEADSEMNANKAMKEIENIIFMDDDQKVKLRDQQLKSN
YNGGQQHRPDGQYNNNNDRQTFIQIPKDVVGLVIGKKGETIKQIKEKSGADKVYMQPENQ
RNQQDDSYQNLIVEGSASQVERVRELVNDIKNQQQQKKQGYNDNFNNNNFNNRGGNQKQE
ARIEMEIPANLAGLVIGSKGSTLQQVGSETRTRCQINQNNNDNRKILIIVGNTEEDCQRA
KEIFQEKMNSRMAGNQNDRDNNQRGGGFNNRGNNNSSRGGGRTFNNRRPRKNADDDEIVE
AYQFESYPTYNLEEQMMHSQQMLLNMQNFYNQQGQYPPQQQVPPAYGNQQQQQPSDSYAV
DSKPGQSTDNLTNTNISTSENNTVNSISPQPQQQAATTEFQQYPQPYGQAPGYDPNQVQM
QISQYLQYQQMYLQTQSYTGPVIEEVLADGTIVSLSQNADDKKKGKRGGRR