Identifiers and Description

Gene Model Identifier

TTHERM_00052189

Standard Name

MED15 (Mediator subunit 15)

Aliases

3824.m03153

Description

hypothetical protein; Possible subunit 15 of Mediator complex. Contains MED15-like region towards C-terminus amino acids 907-1201. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01549.1 3.998688523634227e-123
Description: hypothetical protein (818 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00052189(coding)
ATGCAATATAGAGGAGATTTGAGAAATAATAGCGATTTACTTTCCTATTTTAGTCAATCA
CTTTTGTTTAGCAATCCTTAGAGGAACCCATTAAATGTTCAGTAGCAGTAAAATTACCAA
GATGAGTCAGCCAAAGGCTAATAATAAGCATCGCCAATTTTAAATTTAGAGGTAGCAAAT
CTTTGCATAGGGAGAAGGGATTACCCTTTTACAACAGGTCAAGAGTATGAGTAGCCACAT
AAAAACAACTAAGAACATTTATTAAGAAAAAAACTACTTTCTTTGAAATTGCCTGACTAT
ACAAAAGTGCAAATAAAAGACTAGTAAATAGTGTTCTCCTCCGATATATATAAAATCAGA
ATTGGATTAAAATTTTATGATAATGGCAAGATTATTTTAATGACATTAATTTAAAATGGG
ATTTAGCTTAAGAAGAGGGGATATTTAGCCCAAATTTAGTTCAATTATTAATAGCTTATT
AGTGATGTGACACATATTTGCCTTACTGAAATAGAGCCACTTATTTACAGTAATTATAAA
AGCAATTTTGAAAATTATTACCTATGCTATTTAGATTACCTAATCAGGGCTTAGTTTTCT
GCATAAATACTTTAACAATTAGAAGAAAAGTTTAAGCAATAAATACTTTTAGGCAAAAAA
GGAATTTTAGATGTATTCTTAGGTTAGCTTGAAGAAAATAATTAGTTAATTAGAAGATTA
AGTATAAAGGTATAATGCTTAATGGAATTTCAATAGAATTTAGTAAAACTTAGAAATTAA
AGCAATTAATAATATATCACTATCCATTATGAGTACGTTATTTACAACACTCAGCACTAC
AGTTAATTTATTGAAAGAATTGAAAGAGATCATAAAAGTAATAGCTATCAGGCATTACAA
GAAAAATTAAATAGATTATAGAAGGAATTTTTCAATAAAAATTTTGTTTATGGAAATGAA
AGGAAAATATCTTTTTCGAGCTATTAATTTATAAGGAGAAAAGAATAGATACAAGATATA
GAAAGAGATTATAAAAGACTACTTGATTACGAGTAAATTATGAGTTCATTTAATCCTCTC
CATCTAACTGAGTAGCAACAGCATCTTTAAAAAACTATAGAACTTTCATAAAATGCTAAA
CTAAAATACCCATTACATTTTTTCAGGTCTCCTGTAGACATCATTGATGTATGGAGCGAT
TTGAATTTTACAGAGTTTGAAAGCATTAAAAATGGCTACACATCTTTTAATGCGCCTTAA
TCAAATAACATACAGTCTGAAGATTTGTTAGTTAAGCAATAATATTTAAAGGCTAAATTC
ACTCCCTTTTTAAAACTGGAAAACTATGATCCATAAAAAATAAACGAAAATGCAATATTT
TCAGTTACAAATGGAGAAAATTAAAATTAAAGCTCCTCTTTGAGTTTAGAAGAATAAAGC
TATTAATATGTGGCAGAGAGTTCCTTAGAGTAAGAAATCGATGCTAAAAAAGCAATACAA
TAAAAATATCATTTATACAGTTTATCTTCTCATGTAGTCTTTAATCCAAAATCTTGCCTT
AAAAAAATGTAGGAATATTAAGCTACTTAATTCATGTATTTATTTTTTGCAAACAACAAA
GACAACGATTATCCTACATACAAAACTTTAGACACTGAATGGGGATCTCCAGAAAATTTC
TCCCCTTTACCTTAATATAAAAGATAGCTATTATTTTTTACAAAATTGTAGCATGACTTT
TCTTAAAACTAGATATCAAAGACTTCTCAAAATCATCATCATATACCTTATTAAAATATA
CAAAACTTAAAAGAAGAATAATCAAAAACCATCTTAAAAACATTTTTGCTTGAAATAAAT
CAACTTTTGAACAAAAAAAAATGTAGAGTACCTTTTATTATTTGCCTTAGATCTTTGGAA
AACGATTACATTGAGAGAGTAATAATATCATTAATAAAGGCAAAACCTGTTGAATACTTG
CTTTTAGTTCCTATCATAAAAAGTGGCAAAATTCAATTTCATATTTACATAACTCACCAT
AAAATTCAGCATTAACTTTCCATGGAAGATAATGCATATTTGCTATAAATTCTCTAAGAT
TTCAATTATCACTCCAAGTAGTAGCTTCTAAATCTCCTCCATTCTATCATGATTAGCAGT
GTTATACAAAATTCCTTGCTAAAAACATCATTTAAATTTATGTCTTTTTAAAGAAATTTA
GTTTAAAATTAAAATAAATCTTATGAATTTAGCTTGTGCATCTCATCTTTAATTAAAATG
ATCAAGCAGCAGAAAGAATTTTAAATTGAAATTAAAGTAGATCCTGAAATACCTTTCGAC
ATTTAATTCAATAACATAATAGTAAAAGATTCTCTCGAACCACCAACAGAAAGCCATATT
ATACAATATTTTAAAGTTCTTAAAGAAAACTAATTCGAAACATGGGTTCTATAACTGATA
GAACTCTTCCTCTAAGATACTCTAGAAAGTATCCATGAAAGAACATAAATGATGTATACA
GATGATACTTAATATTATAGACATGAAATTTAAAAGCTTATTAACATTGATGAATCTGAT
TTGAAAAAAATTCCAGAACTGGATAATGTGGTGAAAGATAAGTATTTTCCACAAATGTAG
ATACCCTTACCATAACATTTTAATTTATAGCATCAGCAAAATTAAAAGCTTAGTGGTACT
GTTAGAAATTTTTAAAGAGCTTATGCTTAAAATTAAATTCCATATGCAAGGTCTCCTAAC
CAATCTAATCAGCGCAATCAATCAGGTAATCCATATGAAAATTTAACATTACAGTAACAA
CAGTCATAACCTCGTCCATATCTGCCATAATAAATGGTAAATAATGCTGGAATGAACCCC
ATACCTTAAATAAATCCCTCCTAAAATCGCCCAATATAAAAAAATTAGCTTTACCAATAA
TAACAACACTTATAACCTAATCACACTTTAAACCCTCCAGTAAACCAACAAATCCCTAGG
TAAAACTCATAGCAACCTTTGCATCCTCAAAACCAAACTTTAGTACCCCCAGTATAAAAT
CATAGAATTAGATAAAGTTCTTAGTCTGGCTCTATGAATCAAATTCCTTCATAATAAAAT
TCTAATCCAAATTTAATAGTCCCTCCTCGCTCAGCCCATTAATAAGCTCCTTAACCAGGA
GCAATAGTTTAACCACATGTCCCTTAAATGCACTAGCAAGTCCCTATTCTTCCTCCTCAC
CTATAAAAATAAGACTAACAAATATAAAATCATAATAATAATTTAAATCTACCTCACTAA
TAAGTTTAATAACCTTCTTTAATCACATAAAATAGTAATTCAAATCACCCTAATATATAG
CCACACATACAAAACCCATAATATAATTAATATATGAGTGGCGGAATACAATAGTAATAA
TAAATGCCAATGCCTCCAAGTGGGGGAATACATACACATTAAATTCAAAATATTCCTCAT
TAATAACCACCTATATCAGGAGGAGGAATCTAGCCATAAATAAACAATCCTTAATAAAAT
ATATAGCCCTCACCTTCATTTGATCCTAACATAGGACCTAATGCCTATTAATAACATCAG
CCTTCAGGTATGATAGGCAGATCTAATCATCCCATAGCACCATAAAACTATTGA


>TTHERM_00052189(gene)
ATGCAATATAGAGGAGATTTGAGAAATGTAAATAATACTTTATCAATAAGCTTTTGCTCA
CTTTATTTCATATGCAGACATACACTAAGTTCATATCAAATAAAAAAATTATTATTTTTC
ATTTTGTGCATCCAAAATCAAATAAATAGCATAATATTGGAAAATAATTTTATTCTAAAA
AGCTAATAAATTTTCTAAAAATAGAATAGCGATTTACTTTCCTATTTTAGTCAATCACTT
TTGTTTAGCAATCCTTAGAGGAACCCATTAAATGTTCAGTAGCAGTAAAATTACCAAGAT
GAGTCAGCCAAAGGCTAATAATAAGCATCGCCAATGTAATATTAAAATAAATGTTAGACA
CTTAAGGATAAGCTAAAACTTTTTTATGTAAATTCTTAAATAGTTTAAATTTAGAGGTAG
CAAATCTTTGCATAGGGAGAAGGGATTACCCTTTTACAACAGGTCAAGAGTATGAGTAGC
CACATAGTAAACTCTTTTTACAATTATTAAGCTGATTAGCAAATTAACATATTAATTCCT
TTAATTAAGCAAAAGCTTAGATTTTTGAATAATATTATTTTATGATATAGAAAACAACTA
AGAACATTTATTAAGAAAAAAACTACTTTCTTTGAAATTGCCTGACTATACAAAAGTGCA
AATGTAATTTATAATTTAAATGGATATTGATATTGCTATTTTACAGCTAAAGAATACATT
AAATTTAATAAAATTAACTGTCTAAAAGATCATGCTTTTTAATTATAACTAAAAGAAAAG
ACTAGTAAATAGTGTTCTCCTCCGATATATATAAAATCAGAATTGGATTAAAATTTTATG
ATAATGGCAAGATTATTTTAATGACATTAATTTAAAATGGGATTTAGCTTAAGAAGAGGG
GATATTTAGCCCAAATTTAGTTCAATTATGTATATTTTTCTCTTGATTTAAGTATAGTAT
AAAACATCTATCTCGTATTTTTTATTAAATAAAGTAATAGCTTATTAGTGATGTGACACA
TATTTGCCTTACTGAAATAGAGCCACTTATTTACAGTAATTATAAAAGCAATTTTGAAAA
TTATTACCTATGCTATTTAGATTACCTAATCAGGGCTTAGTTTTCTGCATAAATACTTTA
ACAATTAGAAGAAAAGGTATCTATCTATCTATTTAAAATGCATATTTTATATTCTGAAAG
AATTATATTTCTTATGTTTTTGAGGGTTGTTAGGAAAATACTGACTGATTTTTTTAATAA
AATAGTTTAAGCAATAAATACTTTTAGGCAAAAAAGGAATTTTAGATGTATTCTTAGGTT
AGCTTGAAGAAAATAATTAGTTAATTAGAAGATTAAGTATAAAGGTATAATGCTTAATGG
AATTTCAATAGAATTTAGTAAAACTTAGAAATTAAAGCAATTAATAATATATCACTATCC
ATTATGAGTACGTTATTTACAACACTCAGCACTACAGTTAATTTATTGAAAGAATTGAAA
GAGATCATAAAAGTAATAGCTATCAGGCATTACAAGAAAAATTAAATAGATTATAGAAGG
AATTTTTCAATAAAAATTTTGTTTATGGAAATGAAAGGAAAATATCTTTTTCGAGCTATT
AATTTATAAGGAGAAAAGAATAGATACAAGATATAGAAAGAGATTATAAAAGACTACTTG
ATTACGAGTAAATTATGAGTTCATTTAATCCTCTCCATCTAACTGAGTAGCAACAGCATC
TTTAAAAAACTATAGAACTTTCATAAAATGCTAAACTAAAATACCCATTACATTTTTTCA
GGTCTCCTGTAGACATCATTGATGTATGGAGCGATTTGAATTTTACAGAGTTTGAAAGCA
TTAAAAATGGCTACACATCTTTTAATGCGCCTTAATCAAATAACATACAGTCTGAAGATT
TGTTAGTTAAGCAATAATATTTAAAGGCTAAATTCACTCCCTTTTTAAAACTGGAAAACT
ATGATCCATAAAAAATAAACGAAAATGCAATATTTTCAGTTACAAATGGAGAAAATTAAA
ATTAAAGCTCCTCTTTGAGTTTAGAAGGTAAATAAATAAATATCTATTTATATAAAATTA
TTTTATTTTTTAATATTTTTTTAGAATAAAGCTATTAATATGTGGCAGAGAGTTCCTTAG
AGTAAGAAATCGATGCTAAAAAAGCAATACAATAAAAATATCATTTATACAGTTTATCTT
CTCATGTAGTCTTTAATCCAAAATCTTGCCTTAAAAAAATGTAGGAATATTAAGCTACTT
AATTCATGTATTTATTTTTTGCAAACAACAAAGACAACGATTATCCTACATACAAAACTT
TAGACACTGAATGGGGATCTCCAGAAAATTTCTCCCCTTTACCTTAATATAAAAGATAGC
TATTATTTTTTACAAAATTGTAGCATGACTTTTCTTAAAACTAGATATCAAAGACTTCTC
AAAATCATCATCATATACCTTATTAAAATATACAAAACTTAAAAGAAGAATAATCAAAAA
CCATCTTAAAAACATTTTTGCTTGAAATAAATCAACTTTTGAACAAAAAAAAATGTAGAG
TACCTTTTATTATTTGCCTTAGATCTTTGGAAAACGATTACATTGAGAGAGTAATAATAT
CATTAATAAGTAATAAAAAGAATTTCAATTAATAAATAAATAACCTAATTATTTTAACTA
ATTAATATAGAGGCAAAACCTGTTGAATACTTGCTTTTAGTTCCTATCATAAAAAGTGGC
AAAATTCAATTTCATATTTACATAACTCACCATAAAATTCAGCATTAACTTTCCATGGAA
GATAATGCATATTTGGTAATTTAATTGCTAATTTCAGAACGTTATATTGATTGGTTGTTT
TTCTATTAATTATAGCTATAAATTCTCTAAGATTTCAATTATCACTCCAAGTAGTAGCTT
CTAAGTAAATTTTTAAATCGTTCAATAGGTTAAAAAGATTAATCTATTTTTAATGTTAAA
AAAGATCTCCTCCATTCTATCATGATTAGCAGTGTTATACAAAATTCCTTGCTAAAAACA
TCATTTAAATTTATGTCTTTTTAAAGAAATTTAGTTTAAAATTAAAATAAATCTTATGAA
TTTAGCTTGTGCATCTCATCTTTAATTAAAATGATCAAGCAGCAGAAAGAATTTTAAATT
GAAATTAAAGTAGATCCTGAAATACCTTTCGACATTTAATTCAATAACATAATAGTAAAA
GATTCTCTCGAACCACCAACAGAAAGCCATATTATACAATATTTTAAAGGTAATTAATTA
GTTTTACTATTTTCTCTCTCTTAGTTTAAAACCTTAATTTGAATAAATTATTAACCAAGA
TTTAGTTCGAATTCCCATGATTTATTTGATTATCTAAAATGCAAAAATCACAAATATTTT
ATAAATAATTAATTTATATTAATGGATTAAAGGGATGCTAATTAATGAGGATTTTAGAAT
ATTAATTATTTTATTAAAGAAAATTAAATAAAATCATTTTGTTTAATCAATTTAAATTTT
TATTACCTATTTAATTTTACATTTTTCAAATTTTAATAAACAAAAAAAATAAATAAATAT
TTAAATGATTTAATAAGTGAATTGAAAATATTTTTTGTTTAAATTTAGTTCTTAAAGAAA
ACTAATTCGAAACATGGGTTCTATAACTGATAGAACTCTTCCTCTAAGATACTCTAGAAA
GTATCCATGAAAGAACATAAATGATGTATACAGATGATACTTAATATTATAGACATGAAA
TTTAAAAGCTTATTAACATTGATGAATCTGATTTGAAAAAAATTCCAGAACTGGATAATG
TGGTGAAAGATAAGTATTTTCCACAAATGTAGATACCCTTACCATAACATTTTAATTTAT
AGCATCAGCAAAATTAAAAGCTTAGTGGTACTGTTAGAAATTTTTAAAGAGCTTATGCTT
AAAATTAAATTCCATATGCAAGGTCTCCTAACCAATCTAATCAGCGCAATCAATCAGGTA
ATCCATATGAAAATTTAACATTACAGTAACAACAGTCATAACCTCGTCCATATCTGCCAT
AATAAATGGTAAATAATGCTGGAATGAACCCCATACCTTAAATAAATCCCTCCTAAAATC
GCCCAATATAAAAAAATTAGCTTTACCAATAATAACAACACTTATAACCTAATCACACTT
TAAACCCTCCAGTAAACCAACAAATCCCTAGGTAAAACTCATAGCAACCTTTGCATCCTC
AAAACCAAACTTTAGTACCCCCAGTATAAAATCATAGAATTAGATAAAGTTCTTAGTCTG
GCTCTATGAATCAAATTCCTTCATAATAAAATTCTAATCCAAATTTAATAGTCCCTCCTC
GCTCAGCCCATTAATAAGCTCCTTAACCAGGAGCAATAGTTTAACCACATGTCCCTTAAA
TGCACTAGCAAGTCCCTATTCTTCCTCCTCACCTATAAAAATAAGACTAACAAATATAAA
ATCATAATAATAATTTAAATCTACCTCACTAATAAGTTTAATAACCTTCTTTAATCACAT
AAAATAGTAATTCAAATCACCCTAATATATAGCCACACATACAAAACCCATAATATAATT
AATATATGAGTGGCGGAATACAATAGTAATAATAAATGCCAATGCCTCCAAGTGGGGGAA
TACATACACATTAAATTCAAAATATTCCTCATTAATAACCACCTATATCAGGAGGAGGAA
TCTAGCCATAAATAAACAATCCTTAATAAAATATATAGCCCTCACCTTCATTTGATCCTA
ACATAGGACCTAATGCCTATTAATAACATCAGCCTTCAGGTATGATAGGCAGATCTAATC
ATCCCATAGCACCATAAAACTATTGA


>TTHERM_00052189(protein)
MQYRGDLRNNSDLLSYFSQSLLFSNPQRNPLNVQQQQNYQDESAKGQQQASPILNLEVAN
LCIGRRDYPFTTGQEYEQPHKNNQEHLLRKKLLSLKLPDYTKVQIKDQQIVFSSDIYKIR
IGLKFYDNGKIILMTLIQNGIQLKKRGYLAQIQFNYQQLISDVTHICLTEIEPLIYSNYK
SNFENYYLCYLDYLIRAQFSAQILQQLEEKFKQQILLGKKGILDVFLGQLEENNQLIRRL
SIKVQCLMEFQQNLVKLRNQSNQQYITIHYEYVIYNTQHYSQFIERIERDHKSNSYQALQ
EKLNRLQKEFFNKNFVYGNERKISFSSYQFIRRKEQIQDIERDYKRLLDYEQIMSSFNPL
HLTEQQQHLQKTIELSQNAKLKYPLHFFRSPVDIIDVWSDLNFTEFESIKNGYTSFNAPQ
SNNIQSEDLLVKQQYLKAKFTPFLKLENYDPQKINENAIFSVTNGENQNQSSSLSLEEQS
YQYVAESSLEQEIDAKKAIQQKYHLYSLSSHVVFNPKSCLKKMQEYQATQFMYLFFANNK
DNDYPTYKTLDTEWGSPENFSPLPQYKRQLLFFTKLQHDFSQNQISKTSQNHHHIPYQNI
QNLKEEQSKTILKTFLLEINQLLNKKKCRVPFIICLRSLENDYIERVIISLIKAKPVEYL
LLVPIIKSGKIQFHIYITHHKIQHQLSMEDNAYLLQILQDFNYHSKQQLLNLLHSIMISS
VIQNSLLKTSFKFMSFQRNLVQNQNKSYEFSLCISSLIKMIKQQKEFQIEIKVDPEIPFD
IQFNNIIVKDSLEPPTESHIIQYFKVLKENQFETWVLQLIELFLQDTLESIHERTQMMYT
DDTQYYRHEIQKLINIDESDLKKIPELDNVVKDKYFPQMQIPLPQHFNLQHQQNQKLSGT
VRNFQRAYAQNQIPYARSPNQSNQRNQSGNPYENLTLQQQQSQPRPYLPQQMVNNAGMNP
IPQINPSQNRPIQKNQLYQQQQHLQPNHTLNPPVNQQIPRQNSQQPLHPQNQTLVPPVQN
HRIRQSSQSGSMNQIPSQQNSNPNLIVPPRSAHQQAPQPGAIVQPHVPQMHQQVPILPPH
LQKQDQQIQNHNNNLNLPHQQVQQPSLITQNSNSNHPNIQPHIQNPQYNQYMSGGIQQQQ
QMPMPPSGGIHTHQIQNIPHQQPPISGGGIQPQINNPQQNIQPSPSFDPNIGPNAYQQHQ
PSGMIGRSNHPIAPQNY