Identifiers and Description

Gene Model Identifier

TTHERM_00052310

Standard Name

AAC1 (ADP/ATP Carrier)

Aliases

PreTt11411 | 3.m01987 | 3824.m03166

Description

AAC ADP/ATP transporter on adenylate translocase; Hydrogenosomal ADP/ATP carrier protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01536.1 9.997093137033517e-262
Description: ADP, ATP carrier protein 1 (310 aa)
SGD YBL030C 8.000452576646126e-141
Description: PET9 Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; also imports heme and ATP; phosphorylated; required for viability in many lab strains that carry a sal1 mutation
Oxytricha Contig10229.0.g32 3.000935899181433e-99
Description: Mitochondrial carrier protein
WormBase WBGene00006439 2.9996277075259347e-88
Description: locus:ant-1.1 status:Confirmed UniProt:O45865 protein_id:CAB04874.1
DictyBase DDB_G0267454 2.0008312485874125e-83
Description: ancA on chromosome: 1 position 424007 to 425518
Stentor Coeruleus SteCoe_12441 8.194012623990515e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00052310(coding)
ATGTCTCAAAAGAAGCAAACTACTCCCTTAGATTTCATCAAGGATTTCTTGACTGGTGGT
GTCTCCGCCTCCATTTCCAAGACTATCGCTTCCCCCATCGAAGTCATCAAGATGAGAGTT
TAAAATCAAGATGAAATGATCAAGCAAGGTGCCTTGGACAAGAGATACAACGGTATTGTT
GACTGTTCCAAGAGAATCCTCAATGAAGAAGGTGCTAAGGCTTTCTGGAAGGGTAACTGG
ACTAACGTCTTAAGATATTTCCCCACTCAAGCCTTGAACTTCGCCTTCAAGGATACCTTC
AAGAGAATGTTCAATAAAAAGAAAGAAGACGGTTATGCTATCTGGTTCGCTGCTAACATG
GCTTCCGGTGGTTTAGCTGGTTCCGTCTCTCTCGCTTTCGTCTACTCTTTGGACTACGCC
AGAACTAAGTTAACCAACGATTTAAAATCCTCCAAGAAAGGTGGTCAAAAGTAATACAGC
GGTTTAGTTGATGTTTATAAGAAAACTCTTGCTACCGACGGTGTTGCTGGTCTCTACAGA
GGTTTCGTTATTTCTTGCGTTGGTATTGTTATTTACAGAGGTCTTTACTTCGGTCTCTAC
GATACCGTCAAGCCCTTACTCCCCAGTAACATTAAGAACAACTTCTACGTTAACTTCGGT
GTTGGTTGGACCGTTACCGTCCTCGCCGGTTTGGCCTCTTACCCCATCGATACCATCAGA
AGAAGAATGATGATGACCTCCGGTCAAGCCGTCAAGTACAACGGTTCTATTGACTGTTTC
TAACAAATTGTTGCCAAGGAAGGTGCCCTCTCCTTATTCAAGGGTGCTGGTGCTAACATT
CTTAGAGGTGTTGCTGGTGCTGGTGCTATCTCTGGTTACGACTGGATCCAAAGAAAGATC
GACCCCAATGCCAAGCCCTCTTCTGAGTGA


>TTHERM_00052310(gene)
ATGTCTCAAAAGAAGCAAACTACTCCCTTAGATTTCATCAAGGATTTCTTGACTGGTGGT
GTCTCCGCCTCCATTTCCAAGACTATCGCTTCCCCCATCGAAGTCATCAAGATGAGAGTT
TAAAATCAAGATGAAATGATCAAGCAAGGTGCCTTGGACAAGAGATACAACGGTATTGTT
GACTGTTCCAAGAGAATCCTCAATGAAGAAGGTGCTAAGGCTTTCTGGAAGGGTAACTGG
ACTAACGTCTTAAGATATTTCCCCACTCAAGCCTTGAACTTCGCCTTCAAGGATACCTTC
AAGAGAATGTTCAATAAAAAGAAAGAAGACGGTTATGCTATCTGGTTCGCTGCTAACATG
GCTTCCGGTGGTTTAGCTGGTTCCGTCTCTCTCGCTTTCGTCTACTCTTTGGACTACGCC
AGAACTAAGTTAACCAACGATTTAAAATCCTCCAAGAAAGGTGGTCAAAAGTAATACAGC
GGTTTAGTTGATGTTTATAAGAAAACTCTTGCTACCGACGGTGTTGCTGGTCTCTACAGA
GGTTTCGTTATTTCTTGCGTTGGTATTGTTATTTACAGAGGTCTTTACTTCGGTCTCTAC
GATACCGTCAAGCCCTTACTCCCCAGTAACATTAAGAACAACTTCTACGTTAACTTCGGT
GTTGGTTGGACCGTTACCGTCCTCGCCGGTTTGGCCTCTTACCCCATCGATACCATCAGA
AGAAGAATGATGATGACCTCCGGTCAAGCCGTCAAGTACAACGGTTCTATTGACTGTTTC
TAACAAATTGTTGCCAAGGAAGGTGCCCTCTCCTTATTCAAGGGTGCTGGTGCTAACATT
CTTAGAGGTGTTGCTGGTGCTGGTGCTATCTCTGGTTACGACTGGATCCAAAGAAAGATC
GACCCCAATGCCAAGCCCTCTTCTGAGTGA


>TTHERM_00052310(protein)
MSQKKQTTPLDFIKDFLTGGVSASISKTIASPIEVIKMRVQNQDEMIKQGALDKRYNGIV
DCSKRILNEEGAKAFWKGNWTNVLRYFPTQALNFAFKDTFKRMFNKKKEDGYAIWFAANM
ASGGLAGSVSLAFVYSLDYARTKLTNDLKSSKKGGQKQYSGLVDVYKKTLATDGVAGLYR
GFVISCVGIVIYRGLYFGLYDTVKPLLPSNIKNNFYVNFGVGWTVTVLAGLASYPIDTIR
RRMMMTSGQAVKYNGSIDCFQQIVAKEGALSLFKGAGANILRGVAGAGAISGYDWIQRKI
DPNAKPSSE