Identifiers and Description

Gene Model Identifier

TTHERM_00052500

Standard Name

CEN5 (CENtrin 5)

Aliases

PreTt11430 | 3.m01709 | 3824.m03185

Description

EF hand protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01519.1 1.999447289884935e-116
Description: EF hand family protein (209 aa)
Oxytricha Contig1124.1.g111 8.00344477495519e-22
Description: EF hand
DictyBase DDB_G0279407 0.0000000029989608248573072
Description: calA on chromosome: 3 position 2244074 to 2245039
WormBase WBGene00000552 0.0000000039998859049333245
Description: locus:cmd-1 Calmodulin status:Confirmed UniProt:O16305 protein_id:CCD69969.1
SGD YBR109C 0.0000029996948234116693
Description: CMD1 Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052500(coding)
ATGTCTCGAAGTTCAATGTTTAGCTCTCCTTTAAAGAGAGAAAGACCCTCATCAATATAT
CACAACAACTTTAATAATCTTGGTGTAGTAAACTAAAATGATTTATCATATAATAGTTAA
CTGAGTGAAAGTTAAGCTTTCTCAAATAAAGTTTTTGATGCTAAAGATTATGCTACAGAT
GGTCTTACTGAATAAGAAGTTCACATATACAAATAGGTTTTTGACCTTTATGATTAAACA
GGAGAAGGGTATTTAAATCCTGGTAAGATTAGAAATGCAATGAAAAAATATGGCAACTAT
AATGCAAGTTTGCAATTAGTTTATGAAATACAATCAAATTTTGATAATAACTTAGATGGT
AAAATTGATTTCGAAGAATTTGTTAGAATGATGAGGATGAAACCTTGCTAATAAGACTCT
GCTGAAGATGTCAAACATATTTTCTAATAAATATCAAATTACTAAGATGAAGGAATAACA
CCAGAAGATTTAGTGGAACTGGCTTTAAGTTGCAATGATACATTATCGTATGAAGATGCT
GTAAAAATTATAAAAAAATTAGAACCAAACAGTGAAAAGCTGTCTATGAAGAAGTTTATT
GAATTCAATTTGAGATGCGAATTTTGA


>TTHERM_00052500(gene)
ATGTCTCGAAGTTCAATGTTTAGCTCTCCTTTAAAGAGAGAAAGACCCTCATCAATATAT
CACAACAACTTTAATAATCTTGGTGTAGTAAACTAAAATGATTTATCATATAATAGTTAA
CTGAGTGAAAGTTAAGCTTTCTCAAATAAAGTTTTTGATGCTAAAGATTATGCTACAGAT
GGTCTTACTGAATAAGAAGTTCACATATACAAATAGGTTTTTGACCTTTATGATTAAACA
GGAGAAGGGTATTTAAATCCTGGTAAGATTAGAAATGCAATGAAAAAATATGGCAACTAT
AATGCAAGTTTGCAATTAGTTTATGAAATACAATCAAATTTTGATAATAACTTAGATGGT
AAAATTGATTTCGAAGAATTTGTTAGAATGATGAGGATGAAACCTTGCTAATAAGACTCT
GCTGAAGATGTCAAACATATTTTCTAATAAATATCAAATTACTAAGATGAAGGAATAACA
CCAGAAGATTTAGTGGAACTGGCTTTAAGTTGCAATGATACATTATCGTATGAAGATGCT
GTAAAAATTATAAAAAAATTAGAACCAAACAGTGAAAAGCTGTCTATGAAGAAGTTTATT
GAATTCAATTTGAGATGCGAATTTTGA


>TTHERM_00052500(protein)
MSRSSMFSSPLKRERPSSIYHNNFNNLGVVNQNDLSYNSQLSESQAFSNKVFDAKDYATD
GLTEQEVHIYKQVFDLYDQTGEGYLNPGKIRNAMKKYGNYNASLQLVYEIQSNFDNNLDG
KIDFEEFVRMMRMKPCQQDSAEDVKHIFQQISNYQDEGITPEDLVELALSCNDTLSYEDA
VKIIKKLEPNSEKLSMKKFIEFNLRCEF