Identifiers and Description

Gene Model Identifier

TTHERM_00052620

Standard Name

OLE2 (OLEic acid requiring)

Aliases

PreTt11442 | 3.m01841 | 3824.m03196

Description

OLE2 fatty acid desaturase; Fatty acid desaturase family protein; paralog of OLE1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01505.1 9.997093137033517e-262
Description: fatty acid desaturase (309 aa)
WormBase WBGene00001398 9.999776257620412e-83
Description: locus:fat-6 Delta(9)-fatty-acid desaturase fat-6 status:Partially_confirmed UniProt:G5EGN2 protein_id:CAB08356.1
DictyBase DDB_G0288801 2.9994376937714457e-52
Description: scdA on chromosome: 5 position 1982434 to 1984703
SGD YGL055W 8.001824328206442e-49
Description: OLE1 Delta(9) fatty acid desaturase, required for monounsaturated fatty acid synthesis and for normal distribution of mitochondria

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052620(coding)
ATGCAAGTTTCAGTAAAAAAACACTAAAACTCTACTGAGGGCAAAATCAAGGAGTTTGCT
CACAAAGAAAATACTAAAAATGATCCAATTCAAGAAAAAGAAGAAATAAGAGTTCCTGAG
AGCATTTTTTTAGGAATCATGCATGTTCTTGCTTTTGCTGGTTTGATACTACTATTTACC
TATGATAAATAGACAATAATTAGATCTTTGTGCCTTATGGGTTTTCTCCATTACTTAAGT
TGCTTGGGTATTGGATCTGGAGTTCACAGACTTTGGGCTCATCGTTCTTATAAAGCAAGT
ACTCCATACCGTGTTTTGTTGATGATTTTACAATCACTTGCATTTTAAGGGAGCATTTTC
CATTGGTCTAGAGATCACAGATTGCACCACAAGTTCTCAGACACTGATTTAGATCCTCAC
TCTATGAATAGAGGATTCTTCTTTGCTCATATGGGGTGGCTTTTGGTTAAGAAGAGCAAA
GCTTTAGTAGATGAAGGTTACAAAATTGATGTCTAGGATCTTTTAAATGACCCTGTTGTT
AAATTCCAAAAGAAAAACTATTACAAGCTCTCAACATTAATTTGTTTTATTATTCCAACC
ATTTTAAGCTACTTTATTGTTGGAGGAAGCCTTATTTTTGGATTCTTAACTGCTGGTGTT
TTTAGATATATTTTCATGCTCCACGTTACTTGGTGTGTAAATTCAGTTTGCCACATGTTT
GGAACAAGACCTTACAACCCTGATATTTTACCTACTGAAAACTTGTTTGTTTCTATTTTT
GCTTGCGGTGAAGGATGGCATAATTGGCACCATGAATACCCTAGAGACTGGAGAGCTTGC
GAAAACAAATGGTATAAGTGGAATCCTAATGGCTGGTTTATATAAATTGCTGAATTACTT
GGCTTTGCAAATACACATTTGGAAAAGGCATAATGA


>TTHERM_00052620(gene)
ATGCAAGTTTCAGTAAAAAAACACTAAAACTCTACTGAGGGCAAAATCAAGGAGTTTGCT
CACAAAGAAAATACTAAAAATGATCCAATTCAAGAAAAAGAAGAAATAAGAGTTCCTGAG
AGCATTTTTTTAGGAATCATGCATGTTCTTGCTTTTGCTGGTTTGATACTACTATTTACC
TATGATAAATAGACAATAATTAGATCTTTGTGCCTTATGGGTTTTCTCCATTACTTAAGT
TGCTTGGGTATTGGATCTGGAGTTCACAGACTTTGGGCTCATCGTTCTTATAAAGCAAGT
ACTCCATACCGTGTTTTGTTGATGATTTTACAATCACTTGCATTTTAAGGGAGCATTTTC
CATTGGTCTAGAGATCACAGATTGCACCACAAGTTCTCAGACACTGATTTAGATCCTCAC
TCTATGAATAGAGGATTCTTCTTTGCTCATATGGGGTGGCTTTTGGTTAAGAAGAGCAAA
GCTTTAGTAGATGAAGGTTACAAAATTGATGTCTAGGATCTTTTAAATGACCCTGTTGTT
AAATTCCAAAAGAAAAACTATTACAAGCTCTCAACATTAATTTGTTTTATTATTCCAAGT
AAAATATTTTACCATTCATTTTAAATTTCTTGCACATAACCAAATATAGAAAAAAAGGAG
TTAAACAAATAAAAAACAAATTAATTAAAATTCAACTTTTACTGTTTACAGATTATTACT
TTTAATTACTTGAAAAATAATGTAAATATCTTTATTAACCCAAATTAAATTTATAAAAAG
CCATTTTAAGCTACTTTATTGTTGGAGGAAGCCTTATTTTTGGATTCTTAACTGCTGGTG
TTTTTAGATATATTTTCATGCTCCACGTTACTTGGTGTGTAAATTCAGTTTGCCACATGT
TTGGAACAAGACCTTACAACCCTGATATTTTACCTACTGAAAACTTGTTTGTTTCTATTT
TTGCTTGCGGTGAAGGATGGCATAATTGGCACCATGAATACCCTAGAGACTGGAGAGCTT
GCGAAAACAAATGGTATAAGTGGAATCCTAATGGCTGGTTTATATAAATTGCTGAATTAC
TTGGCTTTGCAAATACACATTTGGAAAAGGCATAATGA


>TTHERM_00052620(protein)
MQVSVKKHQNSTEGKIKEFAHKENTKNDPIQEKEEIRVPESIFLGIMHVLAFAGLILLFT
YDKQTIIRSLCLMGFLHYLSCLGIGSGVHRLWAHRSYKASTPYRVLLMILQSLAFQGSIF
HWSRDHRLHHKFSDTDLDPHSMNRGFFFAHMGWLLVKKSKALVDEGYKIDVQDLLNDPVV
KFQKKNYYKLSTLICFIIPTILSYFIVGGSLIFGFLTAGVFRYIFMLHVTWCVNSVCHMF
GTRPYNPDILPTENLFVSIFACGEGWHNWHHEYPRDWRACENKWYKWNPNGWFIQIAELL
GFANTHLEKAQ