Identifiers and Description

Gene Model Identifier

TTHERM_00056140

Standard Name

ERS3 (glutaminyl-tRNA Synthetase 3)

Aliases

PreTt12997 | 4.m00396 | 3707.m00043

Description

ERS3 glutamylglutaminyl-tRNA synthetase protein; Glutaminyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197
  • positive regulation of catabolic process (IEA) | GO:0009896

Domains

  • ( PF00749 ) tRNA synthetases class I (E
  • ( PF03950 ) tRNA synthetases class I (E
  • ( PF04558 ) Glutaminyl-tRNA synthetase, non-specific RNA binding
  • ( PF05358 ) DicB protein
  • ( TIGR00440 ) glutaminyl-tRNA synthetase
  • ( TIGR00463 ) glutamyl-tRNA synthetase
  • ( TIGR00464 ) glutamyl-tRNA synthetase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_8444 0
Description: None
Tetrahymena borealis EI9_01913.1 9.997093137033517e-262
Description: glutaminyl-tRNA synthetase (778 aa)
DictyBase DDB_G0289481 9.997093137033517e-262
Description: glnS on chromosome: 5 position 2857147 to 2859666
Oxytricha Contig21385.0.g17 9.997093137033517e-262
Description: tRNA synthetases class I (E and Q), catalytic domain
WormBase WBGene00001336 6.999272261191859e-174
Description: locus:qars-1 Probable glutamine--tRNA ligase status:Partially_confirmed UniProt:O62431 protein_id:CAB08998.1
SGD YOR168W 1.999382702437002e-145
Description: GLN4 Glutamine tRNA synthetase, monomeric class I tRNA synthetase that catalyzes the specific glutaminylation of tRNA(Glu); N-terminal domain proposed to be involved in enzyme-tRNA interactions

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00056140(coding)
ATGGAAAGTTTAGCAGAAAGACTCAAAGCCTTCAGTATTGATGAAAAGTAAATCGCTGAT
ATCTTGAAGAACAAGAAGATTTGCGAATCTATTGAAAAGGTTTTAAATTTATCAGGAATT
AACTCCGCTGACAAGAAGAGAGGTAATCTTTTGTATGGTATTGCTACTAAGATTACTCCT
TCTATTGAAGAATTCAGATAGACACTCACAAAGTATGTTGTCGAAGATAAGATTGCTAAT
TAAAATCATCTCGATTACACTATTTCTTATATTGATACTGCTATCAAGAAAGAAGGTAGC
ATTGCTACTGAAGTTCTTGAAAAGAACTGCGGTATTGGCGTCAATATGACTGATGCCTAA
ATCTCTTAAAAGATTAAGGAGTATCTTACATCTAAGAAGGAAGTTTTAGAAAAAATTAGA
TATACACTCAGTATTTCTGACTACCTTAAGGCTCTTCGTGAAATAGTTCCTTTCGCTGAA
GGCAAGCTCCTTTCTACTGAATTTAAAGTTTAACTTGAAGCTATCATAGGACCTGAAACT
GAATAAGATAAGTAGATGAAGGCTGATTTGCTAAAAAAAAAAGCCAAAGAAGAATCTAAC
AAGCACAAGAAGGTTGAAACTGCTGCTACTGAATAGGAAGTTGAAGAACCAAAGAAGAAA
TTAGGTGATATTTTCAATGCCAGAGATCTTGCTTCATCTAGAAACACTCCAGAACTTATC
AAGTAAAGAAACGAATAGTTTGGTGATGTTATTCTTACCCGTTTCCCTCCTGAGCCTAAT
GGTTATCTCCACATTGGTCATGCTAAGTCAATTAATTTCAATTTTGGTATTGCCAGTGAA
TACAATGGTTAATGCTATTTGAGATTCGATGATACCAATCCTGAAAAAGAAAACATGGAA
TATATTAACTCTATTAAAGATAATGTTAAATGGTTAGGAAGAACTCCTTTCAAGACCACT
TACTCTTCTGATAACTTCGAAATTCTCTACTAATGTGCTATCAAGCTCATTAAAAAGGGA
TTCGCTTTCGTTTGTCATTAGAACAAGGAAGAATCAAGAAAGTTCAGAGAATAAGGTATT
CCCTCACCTTACAGAGACAGACCTGTTGAAGAAAATCTCCGTATTTTCGAAGAAATGAGA
CTTGGTCTTTGGGATGAAGGAGCCGCTGTTTTAAGAGCTAAGATTGACTACAAGTCACCC
AACACTACTTTAAGAGATCCTGCCATTTATAGAATTAGATATGTTTCTCACCCTCACGCT
GGTAGCAAATGGTGTATCTATCCTCTCTATGATTACACTCACCCTATTTGCGATTCATTA
GAAGGTATTACTTACTCTCTCTGTACCTTAGAATTCGAAATTAGAAGAGAACTCTATTAC
TGGTACCTTGAAAAGCTCGATATGTATCGTCCCTACGTCTGGGAATTCTCTCGTTTGAAT
GTCTCCAACACTGTTTTGTCAAAGAGAAAGTTATAAGCTTTGGTCTTCGGTAATCACGTT
AAGGGTTGGGATGATCCTAGATTGTTAACAATTTAAGGTATGAGAAGAAGAGGTTACACT
CCTGAAGGTATTAATGCTTTCTGTGATTTAGTTTCTGTCACTCGTAACGGTAATGAAAAT
GTTATTGGATTCTAGTTATTAGAACATTGCATTCGTAAAGATTTGGACAACACTACCAAG
CGTACCATGGCTGTCATCGATCCTGTCAAGGTTACCATTACTAACCTTCCTGATACTTAT
GAATAGGTTCTCGAAGCTCCTGATTTCCCAACTTAAGTCGAAAGAGGATCTCACAAAATC
TCTTTCACCAACTCTGTTTATGTTGAAAGAGAAGATACTTAATTAAAGGATCACAAGGAC
TTCTTTGGTTTAGCTCCAGGAAAAGTTGTTGGTCTTAAGTACGCAGGTGTTGTTAAGTGT
ATTGATGTTAAGGCTAAGGACGGAGTTGTTACTGAAGTTGTTGCTGAATTCATTAAGGAC
GATCCTCCTAAACCCAAGACTTATTTGAATTGGGTTTCTGCTAAAGAAGCTTTTGATTGT
GAAGTTAGAATTTATAATAGTTTATTCACTGAAGATCCTACTTCTTCTGATAAAGAATTC
CTCGAATTACTTAACCCCAACTCTCTTGTTTTCAAGAGCGGTGCCAAGATTAACAAGAAT
ATTATCCCTGAACTCTAACACTTATCTAGATTCTAATTCGAAAGATAAGGTTATTTCGCT
ATCGATTTCGATTCTGATATCACAAAGAAAACTTTCGTCTGGAATAAGATTGTAGGTCTT
TCCGACACTGGCAAATAAAAGGCTTTATAGAGAGTTGCATAGGCTTGA


>TTHERM_00056140(gene)
ATGGAAAGTTTAGCAGAAAGACTCAAAGCCTTCAGTATTGATGAAAAGTAAATCGCTGAT
ATCTTGAAGAACAAGAAGATTTGCGAATCTATTGAAAAGGTTTTAAATTTATCAGGAATT
AACTCCGCTGACAAGAAGAGAGGTAATCTTTTGTATGGTATTGCTACTAAGATTACTCCT
TCTATTGAAGAATTCAGATAGACACTCACAAAGTATGTTGTCGAAGATAAGATTGCTAAT
TAAAATCATCTCGATTACACTATTTCTTATATTGATACTGCTATCAAGAAAGAAGGTAGC
ATTGCTACTGAAGTTCTTGAAAAGAACTGCGGTATTGGCGTCAATATGACTGATGCCTAA
ATCTCTTAAAAGATTAAGGAGTATCTTACATCTAAGAAGGAAGTTTTAGAAAAAATTAGA
TATACACTCAGTATTTCTGACTACCTTAAGGCTCTTCGTGAAATAGTTCCTTTCGCTGAA
GGCAAGCTCCTTTCTACTGAATTTAAAGTTTAACTTGAAGCTATCATAGGACCTGAAACT
GAATAAGATAAGTAGATGAAGGCTGATTTGCTAAAAAAAAAAGCCAAAGAAGAATCTAAC
AAGCACAAGAAGGTTGAAACTGCTGCTACTGAATAGGAAGTTGAAGAACCAAAGAAGAAA
TTAGGTGATATTTTCAATGCCAGAGATCTTGCTTCATCTAGAAACACTCCAGAACTTATC
AAGTAAAGAAACGAATAGTTTGGTGATGTTATTCTTACCCGTTTCCCTCCTGAGCCTAAT
GGTTATCTCCACATTGGTCATGCTAAGTCAATTAATTTCAATTTTGGTATTGCCAGTGAA
TACAATGTAAATATCAATCATAAATTTTACTCTTTTTAAAAACGTTTAAGGGAAATTATT
CTATTTGAAACGTATTTTCATTATCAAAGGCTTAAGAATTAAAAAATTTGTTAGTTAGCT
AGCTATTTTCTCAGTCATAGATTTTATTCTCTTTTCTGAAAAGTTTTATTGCTTGATAAA
ATAAGAGAAGAAGCCAAATAAAATATCCTTATATCGTCTTCTAAGATAAATAGATAAATA
CAAAAATAGTTAAATCAATTAAAATTTAAATTTCAGAAACAAGCTAAAAAAATTCTGCCA
AATATTAATAATATTAATTGATTTATTAGCATATATTTTCTTCAGATATAAGAGACCAGA
AAAATTAGATAAACATAAAGATTATAAATAATACTTAGTTAGTGTGTTAATTAGAAGATA
GATACAAAAAGATTGAATTAGATTTCAAAAAAAAGTTTAAAATTCTCATTTTTTTAAAGC
CACTCTTCAACAATTATTTTATGAGTTATGAGCAGTCATTTATATCAAATTTCCCTTAAA
ATTTTAGCAATTAAACAAATTTTATTCAGAAATTTTAAACATTCGTTAAAGAATTTTGAA
TAAACATTTTAAAATCTTACTTATTTTTAATATTAATAAATAGGGTTAATGCTATTTGAG
ATTCGATGATACCAATCCTGAAAAAGAAAACATGGAATATATTAACTCTATTAAAGATAA
TGTTAAATGGTTAGGAAGAACTCCTTTCAAGACCACTTACTCTTCTGATAACTTCGAAAT
TCTCTACTAATGTGCTATCAAGCTCATTAAAAAGGGATTCGCTTTCGTTTGTCATTAGAA
CAAGGAAGAATCAAGAAAGTTCAGAGAATAAGGTATTCCCTCACCTTACAGAGACAGACC
TGTTGAAGAAAATCTCCGTATTTTCGAAGAAATGAGACTTGGTCTTTGGGATGAAGGAGC
CGTAAATATTAATAAATTTTATTTCACAAATATAGCTTTTAGATAAATCATAAATTTGAA
ATAATATTTGCAATTAAGTTAAAAGAATAAAATAAAATAGTTTTGAGTTTAGCATAATAT
ATAAATTTTTATTAGCTCAATCAAAAAAATATAAAAGCTTTCAAATTAGCTATAAAATTT
TATTTGGTTTATTTATTTTAGCATTCTTAAGCATTTTATATTCGAAATAGGCTGTTTTAA
GAGCTAAGATTGACTACAAGTCACCCAACACTACTTTAAGAGATCCTGCCATTTATAGAA
TTAGATATGTTTCTCACCCTCACGCTGGTAGCAAATGGTGTATCTATCCTCTCTATGATT
ACACTCACCCTATTTGCGATTCATTAGAAGGTATTACTTACTCTCTCTGTACCTTAGAAT
TCGAAATTAGAAGAGAACTCTATTACTGGTACCTTGAAAAGCTCGATATGTATCGTCCCT
ACGTCTGGGAAGTAAACATTTTAGAATATATTTTTACTTTATTTTTTACAATATTTTCAT
GCAAATAAAATAAAGTTCTCTCGTTTGAATGTCTCCAACACTGTTTTGTCAAAGAGAAAG
TTATAAGCTTTGGTCTTCGGTAATCACGTTAAGGGTTGGGATGATCCTAGATTGTTAACA
ATTTAAGGTATGAGAAGAAGAGGTTACACTCCTGAAGGTATTAATGCTTTCTGTGATTTA
GTTTCTGTCACTCGTAACGGTAATGAAAATGTTATTGGATTCTAGTTATTAGAACATTGC
ATTCGTAAAGATTTGGACAACACTACCAAGCGTACCATGGCTGTCATCGATCCTGTCAAG
GTTACCATTACTAACCTTCCTGATACTTATGAATAGGTTCTCGAAGCTCCTGATTTCCCA
ACTTAAGTCGAAAGAGGTAAATTAGATTATTATATATTGAATGAGAAACGATTTATTTTA
AGCTTTAAATTTTATTTCATTTTTACAAAAATAAATATTAAACAAAAAATTTAATTATTT
TAATAGGATCTCACAAAATCTCTTTCACCAACTCTGTTTATGTTGAAAGAGAAGATACTT
AATTAAAGGATCACAAGGACTTCTTTGGTTTAGCTCCAGGAAAAGTTGTTGGTCTTAAGT
ACGCAGGTGTTGTTAAGTGTATTGATGTTAAGGCTAAGGACGGAGTTGTTACTGAAGTTG
TTGCTGAATTCATTAAGGACGATCCTCCTAAACCCAAGACTTATTTGAATTGGGTTTCTG
CTAAAGAAGCTTTTGATTGTGAAGTTAGAATTTATAATAGTTTATTCACTGAAGATCCTA
CTTCTTCTGATAAAGAATTCCTCGAATTACTTAACCCCAACTCTCTTGTTTTCAAGAGCG
GTGCCAAGATTAACAAGAATATTATCCCTGAACTCTAACACTTATCTAGATTCTAATTCG
AAAGATAAGGTTATTTCGCTATCGATTTCGATTCTGATATCACAAAGAAAACTTTCGTCT
GGAATAAGATTGTAGGTCTTTCCGACACTGGCAAATAAAAGGCTTTATAGAGAGTTGCAT
AGGCTTGA


>TTHERM_00056140(protein)
MESLAERLKAFSIDEKQIADILKNKKICESIEKVLNLSGINSADKKRGNLLYGIATKITP
SIEEFRQTLTKYVVEDKIANQNHLDYTISYIDTAIKKEGSIATEVLEKNCGIGVNMTDAQ
ISQKIKEYLTSKKEVLEKIRYTLSISDYLKALREIVPFAEGKLLSTEFKVQLEAIIGPET
EQDKQMKADLLKKKAKEESNKHKKVETAATEQEVEEPKKKLGDIFNARDLASSRNTPELI
KQRNEQFGDVILTRFPPEPNGYLHIGHAKSINFNFGIASEYNGQCYLRFDDTNPEKENME
YINSIKDNVKWLGRTPFKTTYSSDNFEILYQCAIKLIKKGFAFVCHQNKEESRKFREQGI
PSPYRDRPVEENLRIFEEMRLGLWDEGAAVLRAKIDYKSPNTTLRDPAIYRIRYVSHPHA
GSKWCIYPLYDYTHPICDSLEGITYSLCTLEFEIRRELYYWYLEKLDMYRPYVWEFSRLN
VSNTVLSKRKLQALVFGNHVKGWDDPRLLTIQGMRRRGYTPEGINAFCDLVSVTRNGNEN
VIGFQLLEHCIRKDLDNTTKRTMAVIDPVKVTITNLPDTYEQVLEAPDFPTQVERGSHKI
SFTNSVYVEREDTQLKDHKDFFGLAPGKVVGLKYAGVVKCIDVKAKDGVVTEVVAEFIKD
DPPKPKTYLNWVSAKEAFDCEVRIYNSLFTEDPTSSDKEFLELLNPNSLVFKSGAKINKN
IIPELQHLSRFQFERQGYFAIDFDSDITKKTFVWNKIVGLSDTGKQKALQRVAQA