Identifiers and Description

Gene Model Identifier

TTHERM_00058510

Standard Name

MRNN06 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt13036 | 4.m00435 | 3707.m00080

Description

hypothetical protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01954.2 0.000004000864880866421
Description: hypothetical protein (626 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00058510(coding)
ATGAAACAATAGAAAAAACTCTTACTGAAAAAAATTAAAGTAAAAACTTCTCTGACAGTA
AATAAAAAATCTGCAAAAAGTCTTTTACCACCTTTATCAAGAAAAGCTAGTTTATTAGAT
GGATAGAAGGGAAATGCTAATACAGTTTTATCAACTTCAATGCTTAACTCTACACAACCC
TTTAGTAGCTAGTATAATTCTAATACAAGTAGCAACACAACTTTTATTTAGTAAAACTAA
GGAGAATTTTCTAATACTGATAAAAATTCTCAACAAAGTAGTTACTTTAGTAAATTTAGG
TCAACTCAAGAAGTTAATTAAGAAGATAATTCAAATATAGCTCATAGTTAAAGTTTAGTT
AAGAAAGTTAGTTTCTGTGATCAAATCAAAAAAATGAATACCTAGACAAACAAGGCAACG
AATATATAAAACTCTTTTTTGGAACAAATGTAAATCGATACAATAAATGAGATGAAAAAA
AATGATAAAAATAATAATTTAAATAAATCTAAAGAAGAATTAATTCTTCTATATGACTCA
AAAGATTAATAAAAACCTTAACAAAATAATGATTATGAATCGAATAATTACCATTTATTA
TCTTTAAATGATAACAGAAGTGAAATGCAAAAATAAAATATAGATAATTAATCTGTAATT
TTTGAAAAATCAATAGAAATTTATGATAGTAATGAAAATTTATAAGAAATAAGTGCTTAA
AATGAATTTGAAAATTCTTATTTTGAAAGTAATATAAAAAATTTATAAATGCCTAATTTA
GAACAATAAGATTTTAATTAAATTATCAATCAAGACTAATAAAATTTAAACCAAAATAGT
TATCTTGAAATCTCACCCTAGAAGGAATAAAAATAATAAAAAGAAAACCTAAATTCTTCT
TCTCCAAAATTAGGTTCAAGCGAGTTTTCTTTAAATAACAATAATTAAAATGAAAATTCT
TGTCAATATTAACATTAATTGGAAGACAATAATTGCTAATCTATGAAAAAATCAATTTAA
AAAAGTTAATACACATAAAATGATGAAAAATAAGAGTTTGATAAAAAGGAAATATCAAAT
TTTTTAAATAATTCATTTTAAATGAATTAAATTTACAACTAAAATAATGAATAATAAGAA
GAGGAAGAATCAATAAAAAAGCAATCCTAAATACAGTTTAAAGGTTAAGCTAATTTAGAT
TATTGCTACAACTCAAACTAATCCATAGATTATATGACTAAAAGTGTTTAATTTTATGAT
TCAGAAGAAAATTCTATTTAAAACAATAGATCTGACTTTGTAGAAAACAATTAAAATGGT
CTTTAATAAAATATTACGTTTGAGTAATATTTTTAGATTTTATCTTAGAAATAGAATATT
CAATAAGAAAATGGCTAGTTAACACTGACCTTTTCTAAGAATAATGACTCTACTAATTAG
TGTATTGATTTAAAAAATCATAGAGGCACCTTTAATAAAAATGAACAATCCCAAAAATCT
ATTTGTTAAAATTTTTTAGTAGGAATTCCTTAAGATTGTGTGCATTCTCATTATGATATA
TAAGAATAAAAATAAGTAAGAAATGATTTTTCTGCAAAATTGAAATAAATAGTTTAACAT
AAATAACTTCAATTTCATAATTAAAAATAGCAAAGTTAAACTGAAAAAATAGATTAAAAA
ACTATTGTGTCTGAAAATTAAATAATAGACAGCAATATTACAACTGACCCCTCATATTCG
TATCAATAATTTAAATTACAGAACTAAAATTAATAATAGAAAATGCTAACAAGTAACATA
ACCAATGAAAATAGATTCTCTTTCTGTAACAATGCTTCATTTAATGATAATCTTCATCTG
TAAAATTAATCATAAAAAAGCTATTATTACAATAATATTGAACAGGAAGATTAAATCAAG
CAAATTTAAGGAAGAAAAATAAATCAGTAAGAGTTAAATAATGATTTTGAAAATAAAGAA
AATAATTCTTTAAAAAATAAATTTGATAAAACTCAACAAAATTAAAAAGCCAAATCACAA
TAATAAAAAGTTAAAATTGTCTAAATAGACCTATTAAAAGAGCTTTCATAAAATAATCTC
AAATTTGATTAAGATTTTTAAGAGAAAGATAATGTTTATGTTCCTTAAATATTCTATAAT
GAAAATTCACAATATAGGCATTAAGATCACAATTAGTTATCCTAAAATTTATACCTGCTT
TTATAAATCAAATCATAGAAAATAGAATTCTGA


>TTHERM_00058510(gene)
ATGAAACAATAGAAAAAACTCTTACTGAAAAAAATTAAAGTAAAAACTTCTCTGAGTAAA
ATTAAAATGAAAAAGTAGATTTAGATGCAAAATAAAAAGCAGTAAATAAAAAATCTGCAA
AAAGTCTTTTACCACCTTTATCAAGAAAAGCTAGTTTATTAGATGGATAGAAGGGAAATG
CTAATACAGTTTTATCAACTTCAATGCTTAACTCTACACAACCCTTTAGTAGCTAGTATA
ATTCTAATACAAGTAGCAACACAACTTTTATTTAGTAAAACTAAGGAGAATTTTCTAATA
CTGATAAAAATTCTCAACAAAGTAGTTACTTTAGTAAATTTAGGTCAACTCAAGAAGTTA
ATTAAGAAGATAATTCAAATATAGCTCATAGTTAAAGTTTAGTTAAGAAAGTTAGTTTCT
GTGATCAAATCAAAAAAATGAATACCTAGACAAACAAGGCAACGAATATATAAAACTCTT
TTTTGGAACAAATGTAAATCGATACAATAAATGAGATGAAAAAAAATGATAAAAATAATA
ATTTAAATAAATCTAAAGAAGAATTAATTCTTCTATATGACTCAAAAGATTAATAAAAAC
CTTAACAAAATAATGATTATGAATCGAATAATTACCATTTATTATCTTTAAATGATAACA
GAAGTGAAATGCAAAAATAAAATATAGATAATTAATCTGTAATTTTTGAAAAATCAATAG
AAATTTATGATAGTAATGAAAATTTATAAGAAATAAGTGCTTAAAATGAATTTGAAAATT
CTTATTTTGAAAGTAATATAAAAAATTTATAAATGCCTAATTTAGAACAATAAGATTTTA
ATTAAATTATCAATCAAGACTAATAAAATTTAAACCAAAATAGTTATCTTGAAATCTCAC
CCTAGAAGGAATAAAAATAATAAAAAGAAAACCTAAATTCTTCTTCTCCAAAATTAGGTT
CAAGCGAGTTTTCTTTAAATAACAATAATTAAAATGAAAATTCTTGTCAATATTAACATT
AATTGGAAGACAATAATTGCTAATCTATGAAAAAATCAATTTAAAAAAGTTAATACACAT
AAAATGATGAAAAATAAGAGTTTGATAAAAAGGAAATATCAAATTTTTTAAATAATTCAT
TTTAAATGAATTAAATTTACAACTAAAATAATGAATAATAAGAAGAGGAAGAATCAATAA
AAAAGCAATCCTAAATACAGTTTAAAGGTTAAGCTAATTTAGATTATTGCTACAACTCAA
ACTAATCCATAGATTATATGACTAAAAGTGTTTAATTTTATGATTCAGAAGAAAATTCTA
TTTAAAACAATAGATCTGACTTTGTAGAAAACAATTAAAATGGTCTTTAATAAAATATTA
CGTTTGAGTAATATTTTTAGATTTTATCTTAGAAATAGAATATTCAATAAGAAAATGGCT
AGTTAACACTGACCTTTTCTAAGAATAATGACTCTACTAATTAGTGTATTGATTTAAAAA
ATCATAGAGGCACCTTTAATAAAAATGAACAATCCCAAAAATCTATTTGTTAAAATTTTT
TAGTAGGAATTCCTTAAGATTGTGTGCATTCTCATTATGATATATAAGAATAAAAATAAG
TAAGAAATGATTTTTCTGCAAAATTGAAATAAATAGTTTAACATAAATAACTTCAATTTC
ATAATTAAAAATAGCAAAGTTAAACTGAAAAAATAGATTAAAAAACTATTGTGTCTGAAA
ATTAAATAATAGACAGCAATATTACAACTGACCCCTCATATTCGTATCAATAATTTAAAT
TACAGAACTAAAATTAATAATAGAAAATGCTAACAAGTAACATAACCAATGAAAATAGAT
TCTCTTTCTGTAACAATGCTTCATTTAATGATAATCTTCATCTGTAAAATTAATCATAAA
AAAGCTATTATTACAATAATATTGAACAGGAAGATTAAATCAAGCAAATTTAAGGAAGAA
AAATAAATCAGTAAGAGTTAAATAATGATTTTGAAAATAAAGAAAATAATTCTTTAAAAA
ATAAATTTGATAAAACTCAACAAAATTAAAAAGCCAAATCACAATAATAAAAAGTTAAAA
TTGTCTAAATAGACCTATTAAAAGAGCTTTCATAAAATAATCTCAAATTTGATTAAGATT
TTTAAGAGAAAGATAATGTTTATGTTCCTTAAATATTCTATAATGAAAATTCACAATATA
GGCATTAAGATCACAATTAGTTATCCTAAAATTTATAGTAAGATAATAATCAAAAATAAT
CAAATAAAAATGTTAATAAAGCCTGCTTTTATAAATCAAATCATAGAAAATAGAATTCTG
A


>TTHERM_00058510(protein)
MKQQKKLLLKKIKVKTSLTVNKKSAKSLLPPLSRKASLLDGQKGNANTVLSTSMLNSTQP
FSSQYNSNTSSNTTFIQQNQGEFSNTDKNSQQSSYFSKFRSTQEVNQEDNSNIAHSQSLV
KKVSFCDQIKKMNTQTNKATNIQNSFLEQMQIDTINEMKKNDKNNNLNKSKEELILLYDS
KDQQKPQQNNDYESNNYHLLSLNDNRSEMQKQNIDNQSVIFEKSIEIYDSNENLQEISAQ
NEFENSYFESNIKNLQMPNLEQQDFNQIINQDQQNLNQNSYLEISPQKEQKQQKENLNSS
SPKLGSSEFSLNNNNQNENSCQYQHQLEDNNCQSMKKSIQKSQYTQNDEKQEFDKKEISN
FLNNSFQMNQIYNQNNEQQEEEESIKKQSQIQFKGQANLDYCYNSNQSIDYMTKSVQFYD
SEENSIQNNRSDFVENNQNGLQQNITFEQYFQILSQKQNIQQENGQLTLTFSKNNDSTNQ
CIDLKNHRGTFNKNEQSQKSICQNFLVGIPQDCVHSHYDIQEQKQVRNDFSAKLKQIVQH
KQLQFHNQKQQSQTEKIDQKTIVSENQIIDSNITTDPSYSYQQFKLQNQNQQQKMLTSNI
TNENRFSFCNNASFNDNLHLQNQSQKSYYYNNIEQEDQIKQIQGRKINQQELNNDFENKE
NNSLKNKFDKTQQNQKAKSQQQKVKIVQIDLLKELSQNNLKFDQDFQEKDNVYVPQIFYN
ENSQYRHQDHNQLSQNLYLLLQIKSQKIEF