Identifiers and Description

Gene Model Identifier

TTHERM_00066880

Standard Name

RAB40 (RAB GTPase 40)

Aliases

PreTt13178 | 4.m00577 | 3707.m00215

Description

RAB40 Rab-family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02088.1 2.0000211193600847e-137
Description: Ras family protein (232 aa)
DictyBase DDB_G0276399 1.9997255150861791e-53
Description: rab8B on chromosome: 2 position 6878753 to 6879364
Oxytricha Contig22392.0.g29 4.999934616708877e-52
Description: Ras family
WormBase WBGene00004272 9.998397555368434e-52
Description: locus:rab-8 status:Confirmed UniProt:G5EFC1 protein_id:CCD68351.1
SGD YFL038C 4.000139296874041e-45
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
Stentor Coeruleus SteCoe_24985 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00066880(coding)
ATGCACTAGAAAGAATCAAAAAAAGATATTGTAGCAAAAGTTTTAGTCATAGGAGAAGCA
AAAGTTGGTAAAACATCTATATTGACAAGATATACAGAAGGGTCTTTTCAAGAAAGCATG
ATTCCTACCTTAGGTATAGATTATAGATTTAAGAAATTATTTGTCAAAGGGTAGGAAATA
AAGCTTTAGATTTGGGATACTGCTGGCTAGGAGAGATTCAGAGCTATTACTTAAAATTTC
TATAAAGGAGCGATGGGAATTATTTTAGTTTTTGACTTAACTGATCCTAAAACTTTTAAA
ACTCTTTCAAACTGGATCGAAAATATTAAATAATATTCTGGATCAGAAGCATGTAGAATT
CTCCTTGGAAACAAATGTGATATATCTTAAAATTAAATTCCAAAGCAAGACATATAAAAT
TTGGCAAATTAAAATAAAATTTAGTACTTTGAAACATCAGCAAAAAGTAACGAAGGCATA
TAGTAGGCTTTTTAGTAGATAGCAGATGACATAGCGAATAAATTCTTTAGCGAGTTAATA
AATATATAATCCGACCAAAAATTAGACTTAGACAACTCTTTAATAAGGTCTCCATCTTCG
ATAAAAAGGGAAGAGTAGCAATAAGCACTTTAACTATAAGTATAAAAAAGTCCTAGAAAG
AAAACTGAATCAGAAAGCTGCTGTTCATGA


>TTHERM_00066880(gene)
ATGCACTAGAAAGAATCAAAAAAAGATATTGTAGCAAAAGTTTTAGTCATAGGAGAAGCA
AAAGTTGGTAAAACATCTATATTGACAAGATATACAGAAGGGTCTTTTCAAGAAAGCATG
ATTCCTACCTTAGGTAATATTGAAATGAAAATAGCTAAAATTTTAAGGAAATAATATTCA
TTATTTACAATTAGTGCTAGCTAGCTTGCACTCCTGATTAAATATTTCTTATATATTTAT
TTTAAAATAGGTATAGATTATAGATTTAAGAAATTATTTGTCAAAGGGTAGGAAATAAAG
CTTTAGATTTGGGATACTGCTGGCTAGGAGAGATTCAGAGCTATTACTTAAAATTTCTAT
AAAGGAGCGATGGGAATTATTTTAGTTTTTGACTTAACTGATCCTAAAACTTTTAAAACT
CTTTCAAACTGGATCGAAAATATTAAATAATATTCTGGATCAGAAGCATGTAGAATTCTC
CTTGGAAACAAATGTGATATATCTTAAAATTAAATTCCAAAGCAAGACATATAAAATTTG
GCAAATTAAAATAAAATTTAGTACTTTGAAACATCAGCAAAAAGTAACGAAGGCATATAG
TAGGCTTTTTAGTAGATAGCAGATGACATAGCGAATAAATTCTTTAGCGAGTTAATAAAT
ATATAATCCGACCAAAAATTAGACTTAGACAACTCTTTAATAAGGTCTCCATCTTCGATA
AAAAGGGAAGAGTAGCAATAAGCACTTTAACTATAAGTATAAAAAAGTCCTAGAAAGAAA
ACTGAATCAGAAAGCTGCTGTTCATGA


>TTHERM_00066880(protein)
MHQKESKKDIVAKVLVIGEAKVGKTSILTRYTEGSFQESMIPTLGIDYRFKKLFVKGQEI
KLQIWDTAGQERFRAITQNFYKGAMGIILVFDLTDPKTFKTLSNWIENIKQYSGSEACRI
LLGNKCDISQNQIPKQDIQNLANQNKIQYFETSAKSNEGIQQAFQQIADDIANKFFSELI
NIQSDQKLDLDNSLIRSPSSIKREEQQQALQLQVQKSPRKKTESESCCS