Identifiers and Description

Gene Model Identifier

TTHERM_00070960

Standard Name

MRNC05 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt13286 | 4.m00685 | 3707.m00320

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02203.1 3.9980080607810995e-121
Description: hypothetical protein (253 aa)
Oxytricha Contig11833.0.g64 0.00000000000001000191320216021
Description: MORN repeat
Stentor Coeruleus SteCoe_27863 0.00000011253517471925912
Description: None
DictyBase DDB_G0349488 0.00000030014504373857585
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00070960(coding)
ATGGACTTGGATCAATTTTAAGAAAACTTACTGACATAGATAAAGAAATTCACGGAACAA
ATCAAATAAAATGTTTCGAAAGACTAAATATCATTAGACAGATTTAAAAATCATTTTTTA
TTTATATCCAATCAAATAAATAACTAATTAGACAAACTAAAAAGTATAATATTTTTTGAT
TCTTCTAATGTGGCAGAAGAGTAATACAAAAAAGAAAAGTAAAAAAACTCGCAAGATATA
AAATCGCTTGTTTAAAAATTAAGTAAGTAAGTGAGAGCTAGTTTAGAGTAAAGAGGAGAT
TTCTTTTTTGAGAATGTTGAATTAGAGAATTTTGAAGCTCCTGCATTAGTTTTTAAAAAG
TTTACTAATTGTTGTGGTTATTTTTAAATGAAAGATGAGTAGAGAAATGGAAGAGGAATT
GAGTTTTTTGACTCAGGTGCTTTTTATGAAGGGTATTTTAAAAATGACAAGGCTTGTGGA
AAGGGATACTATATATCTTCTACTGGATTAATTCACTAAGGGTATAATAAAGATGATGCC
TATCAAGGATATGGAGAGTGGCCCTTATAAGAATCATATATAGGTGAACATGATGATAAT
CAAGCCAATGGTTATGGAAAAAAATTCTACAAAAATGGTGAAATATATCATGGATTTTGG
AAAGATAATAAAAGATTTGGATATGGTGAATTATATAGCAAAGGTTCATTAATTAGCAGA
GGTATATATCACAATGATAAAATAATAAAGTAGATTTGA


>TTHERM_00070960(gene)
ATGGACTTGGATCAATTTTAAGAAAACTTACTGACATAGATAAAGAAATTCACGGAACAA
ATCAAATAAAATGTTTCGAAAGACTAAATATCATTAGACAGATTTAAAAATCATTTTTTA
TTTATATCCAATCAAATAAATAACTAATTAGACAAACTAAAAAGTATAATATTTTTTGAT
TCTTCTAATGTGGCAGAAGAGTAATACAAAAAAGAAAAGTAAAAAAACTCGCAAGATATA
AAATCGCTTGTTTAAAAATTAAGTAAGTAAGTGAGAGCTAGTTTAGAGTAAAGAGGAGAT
TTCTTTTTTGAGAATGTTGAATTAGAGAATTTTGAAGCTCCTGCATTAGTTTTTAAAAAG
TTTACTAATTGTTGTGGTTATTTTTAAATGAAAGATGAGTAGAGAAATGGAAGAGGAATT
GAGTTTTTTGACTCAGGTAAATAAAAATTTTTTTATTTTATTGCATATTAATTATTAACT
TAGGTGCTTTTTATGAAGGGTATTTTAAAAATGACAAGGCTTGTGGAAAGGGATACTATA
TATCTTCTACTGGATTAATTCACTAAGGGTATAATAAAGATGATGCCTATCAAGGATATG
GAGAGTGGCCCTTATAAGAATCATATATAGGTGAACATGATGATAATCAAGCCAATGGTT
ATGGAAAAAAATTCTACAAAAATGGTGAAATATATCATGGATTTTGGAAAGATAATAAAA
GATTTGGATATGGTGAATTATATAGCAAAGGTTCATTAATTAGCAGAGGTATATATCACA
ATGATAAAATAATAAAGTAGATTTGA


>TTHERM_00070960(protein)
MDLDQFQENLLTQIKKFTEQIKQNVSKDQISLDRFKNHFLFISNQINNQLDKLKSIIFFD
SSNVAEEQYKKEKQKNSQDIKSLVQKLSKQVRASLEQRGDFFFENVELENFEAPALVFKK
FTNCCGYFQMKDEQRNGRGIEFFDSGAFYEGYFKNDKACGKGYYISSTGLIHQGYNKDDA
YQGYGEWPLQESYIGEHDDNQANGYGKKFYKNGEIYHGFWKDNKRFGYGELYSKGSLISR
GIYHNDKIIKQI