Identifiers and Description

Gene Model Identifier

TTHERM_00075790

Standard Name

CIDE1 (Conjugation Induced DNA Elimination Protein)

Aliases

PreTt10024 | 5.m00375 | 3828.m01286

Description

hypothetical protein; Protein strictly expressed during conjugation; colocalizes in developing macronucleus in DNA elimination bodies

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07140.1 6.996525358388811e-93
Description: hypothetical protein (324 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00075790(coding)
ATGATTACTCATGATTAAAATGATAATGAATTGGAAGTAGACGACAGAAGAGAAATTGAG
AGGCTTAAATTGATTGAATAATCTATCAGGACAAAAGTGTAAATGCTATGTGAATACCAC
TCAGAGGTTAACAGGCAGATAATGTATTTAGAGAAAAATTATGAAAATTTACAGGGTGGC
AGCTTGCTTGGAGATATTTAAAGTTAGATTTAGTTATAAAATACGAATAAACTTACTAAA
AATGGTTCAAACGTATATAATGATAATATAACAAATAACTATAATTATTACTAAGACAAA
AATGATGGTGGCAATATTTTTTAGGAAGATGAAGAAGAGTACTTTGAAGAAGAATAAGAC
GAAGAAGATTAAAATGAGTTGAATTTATCTAAATAAAATGATAGAAGCTTATTTCAAAAT
GAGATAATAGATAAAAATCATTTGTTAGTTGATATGAGTTAGATGTTTCCAAAACTAATG
AAACCAAGACAACAGAATATCCAAAAAGATGAACCAAAAAAGAAAAGAATATCGACATTA
TTATAAACTAAGAAAATGTATCCTTTTAAAAAGATGAAACCACTTCCTAACGATGAGCCT
GGGATTGTTTGCCAAAAGTTGGCCATGAAAGATAAATATGAGAAATTTTTGAAGAAATTG
AAACAAGAAATGCCTTATTATATAAGTGATTATGGATAAATTAGGTATCCGATTTATGTA
AAAAAGAAAGTGGCATTTTTTTGCAGATATATAAGCAGAACTAAACTTGTAGAAGACACA
AGAATAGGTGCTGAGGCAGTAGCCAAATGGGTAAAAGTATACTGTGATTACATGGACGAC
AAACTTGAGAACGGAGAACCTAACGAAACTTTTGAAGAATACGTCAAATAAAAACAAACA
AAAAGCGCATATATAATAAAAAAAAAGCAGCTTAATTGCTAACCAAACTTAAATCAGGCC
ATTTTAAAGCAAGTCCAACCAGCTAGTTGGTAAAATCAGGAAAATCATAAAAAAGTAGAC
AATTAGAAAAACAAATATAATTTCAAAATGTCTTGA


>TTHERM_00075790(gene)
ATGATTACTCATGATTAAAATGATAATGAATTGGAAGTAGACGACAGAAGAGAAATTGAG
AGGCTTAAATTGATTGAATAATCTATCAGGACAAAAGTGTAAATGCTATGTGAATACCAC
TCAGAGGTTAACAGGCAGATAATGTATTTAGAGAAAAATTATGAAAATTTACAGGGTGGC
AGCTTGCTTGGAGATATTTAAAGTTAGATTTAGTTATAAAATACGAATAAACTTACTAAA
AATGGTTCAAACGTATATAATGATAATATAACAAATAACTATAATTATTACTAAGACAAA
AATGATGGTGGCAATATTTTTTAGGAAGATGAAGAAGAGTACTTTGAAGAAGAATAAGAC
GAAGAAGATTAAAATGAGTTGAATTTATCTAAATAAAATGATAGAAGCTTATTTCAAAAT
GAGATAATAGATAAAAATCATTTGTTAGTTGATATGAGTTAGATGTTTCCAAAACTAATG
AAACCAAGACAACAGAATATCCAAAAAGATGAACCAAAAAAGAAAAGAATATCGACATTA
TTATAAACTAAGAAAATGTATCCTTTTAAAAAGATGAAACCACTTCCTAACGATGAGCCT
GGGATTGTTTGCCAAAAGTTGGCCATGAAAGATAAATATGAGAAATTTTTGAAGAAATTG
AAACAAGAAATGCCTTATTATATAAGTGATTATGGATAAATTAGGTATCCGATTTATGTA
AAAAAGAAAGTGGCATTTTTTTGCAGATATATAAGCAGAACTAAACTTGTAGAAGACACA
AGAATAGGTGCTGAGGCAGTAGCCAAATGGGTAAAAGTATACTGTGATTACATGGACGAC
AAACTTGAGAACGGAGAACCTAACGAAACTTTTGAAGAATACGTCAAATAAAAACAAACA
AAAAGCGCATATATAATAAAAAAAAAGCAGCTTAATTGCTAACCAAACTTAAATCAGGCC
ATTTTAAAGCAAGTCCAACCAGCTAGTTGGTAAAATCAGGAAAATCATAAAAAAGTAGAC
AATTAGAAAAACAAATATAATTTCAAAATGTCTTGA


>TTHERM_00075790(protein)
MITHDQNDNELEVDDRREIERLKLIEQSIRTKVQMLCEYHSEVNRQIMYLEKNYENLQGG
SLLGDIQSQIQLQNTNKLTKNGSNVYNDNITNNYNYYQDKNDGGNIFQEDEEEYFEEEQD
EEDQNELNLSKQNDRSLFQNEIIDKNHLLVDMSQMFPKLMKPRQQNIQKDEPKKKRISTL
LQTKKMYPFKKMKPLPNDEPGIVCQKLAMKDKYEKFLKKLKQEMPYYISDYGQIRYPIYV
KKKVAFFCRYISRTKLVEDTRIGAEAVAKWVKVYCDYMDDKLENGEPNETFEEYVKQKQT
KSAYIIKKKQLNCQPNLNQAILKQVQPASWQNQENHKKVDNQKNKYNFKMS