Identifiers and Description

Gene Model Identifier

TTHERM_00075840

Standard Name

CTH62 (CaTHepsin 62)

Aliases

PreTt10029 | 5.m00380 | 3828.m01291

Description

CTH62 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07132.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (377 aa)
WormBase WBGene00000776 2.000555387360374e-52
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Oxytricha Contig19008.0.g54 1.9998745702418095e-48
Description: Papain family cysteine protease
DictyBase DDB_G0281605 3.998479955315009e-46
Description: cfaD on chromosome: 3 position 4701100 to 4702904
Stentor Coeruleus SteCoe_27084 9.602680054508676e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00075840(coding)
ATGATTAAGTATATTATTTTTGCTACTCTTCTTTTAAGTGTAGTATCTTGCAAGCCAAAA
TGGCACTAACTTTAAAATTACACTTTTGAATAGTACATAGTTGATTTCGAAAAGGAATAC
GAAGTCGATTCTGTAGAATACAATCAAAGAAAGTAGACCTTCGAAAAGAATTTGGTTGAA
ATCATTGCTTTTAATAATAAGGATCATTCATACAAAAAGGGTGTTAACAGAAACACTGAC
TTAACTACTAAGGAGTTCTAAGTTTAACTTGGTTTAAAGAAGTCAATGAAGAACAGAAAA
AATCCTATTCAACGTTTGCTCGCTAAAAATAATACTGCTGCCAGCTTAACTGATTTACCT
TAAAGTGTTGATTGGAGATAAAAGGGTGTTGTTTCACCTGTTAAGGACTAAGGTGGTTGT
GGTTCATGCTGGGCTTTCGCTTCAGCTGCTGTTTTAGAAAGCGCTGCTGCTATTGCTGCT
GGACCTGGCTAATTAAAAACTCTTTCTACTTAACAACTTGTTTCTTGCGTTCCTAATCCC
AACTAGTGTGGTGGTACTGGTGGTTGCTCTGGAGCAGTTGCTGAATTAGCCTTCTCTTAC
ACTACCTTATATGGTATTACTTCTGAATATAAATATAGTTATTAGTCCTACTTTGGTACA
ACTTACAGCTGCAAGTACGATCCTAAGACTTAAAGTGCTGAAGTTATTAACTAAGGTTAT
GCTAATGTTACTCCCAACGATTAAAATGCTCTCCTTGAAGCTGTTGCTACAGTTGGTCCT
ATTGCCATTTCTGTAGATGCTTCTAACTGGGCTAGCTACGAAGAAGGTGTTTTTGATGGT
TGTGACTATTCTAAAAACGTTGACATCAATCATGCTGTCGTTTTAGTTGGTTATGGTACT
GATCCTAAGTACGGTGATTACTGGTTAGTCAGAAACTCTTGGGGAACCGACTACGGTGAG
GATGGTTACATTAGAGTCAAGAGAGAATCAGTTGCCTAATGTGCTATGGATACAACTCCT
ACTGATGGTTTTGGTTGTGCTGGTGATGAAGAACCTATTAAAGTTTGTGGTATGTGTGGT
ATTCTCTCTGACAGCGCTTATCCTCTTAAAGTCCAAGTTATTGGTTGA


>TTHERM_00075840(gene)
ATGATTAAGTATATTATTTTTGCTACTCTTCTTTTAAGTGTAGTATCTTGCAAGCCAAAA
TGGCACTAACTTTAAAATTACACTTTTGAATAGTACATAGTTGATTTCGAAAAGGAATAC
GAAGTCGATTCTGTAGAATACAATCAAAGAAAGTAGACCTTCGAAAAGAATTTGGTTGAA
ATCATTGCTTTTAATAATAAGGATCATTCATACAAAAAGGGTGTTAACAGAAACACTGAC
TTAACTACTAAGGAGTTCTAAGTTTAACTTGGTTTAAAGAAGTCAATGAAGAACAGAAAA
AATCCTATTCAACGTTTGCTCGCTAAAAATAATACTGCTGCCAGCTTAACTGATTTACCT
TAAAGTGTTGATTGGAGATAAAAGGGTGTTGTTTCACCTGTTAAGGACTAAGGTGGTTGT
GGTTCATGCTGGGCTTTCGCTTCAGCTGCTGTTTTAGAAAGCGCTGCTGCTATTGCTGCT
GGACCTGGCTAATTAAAAACTCTTTCTACTTAACAACTTGTTTCTTGCGTTCCTAATCCC
AACTAGTGTGGTGGTACTGGTGGTTGCTCTGGAGCAGTTGCTGAATTAGCCTTCTCTTAC
ACTACCTTATATGGTATTACTTCTGAATATAAATATAGTTATTAGTCCTACTTTGGTACA
ACTTACAGCTGCAAGTACGATCCTAAGACTTAAAGTGCTGAAGTTATTAACTAAGGTTAT
GCTAATGTTACTCCCAACGATTAAAATGCTCTCCTTGAAGCTGTTGCTACAGTTGGTCCT
ATTGCCATTTCTGTAGATGCTTCTAACTGGGCTAGCTACGAAGAAGGTGTTTTTGATGGT
TGTGACTATTCTAAAAACGTTGACATCAATCATGCTGTCGTTTTAGTTGGTTATGGTACT
GATCCTAAGTACGGTGATTACTGGTTAGTCAGAAACTCTTGGGGAACCGACTACGGTGAG
GATGGTTACATTAGAGTCAAGAGAGAATCAGTTGCCTAATGTGCTATGGATACAACTCCT
ACTGATGGTTTTGGTTGTGCTGGTGATGAAGAACCTATTAAAGTTTGTGGTATGTGTGGT
ATTCTCTCTGACAGCGCTTATCCTCTTAAAGTCCAAGTTATTGGTTGA


>TTHERM_00075840(protein)
MIKYIIFATLLLSVVSCKPKWHQLQNYTFEQYIVDFEKEYEVDSVEYNQRKQTFEKNLVE
IIAFNNKDHSYKKGVNRNTDLTTKEFQVQLGLKKSMKNRKNPIQRLLAKNNTAASLTDLP
QSVDWRQKGVVSPVKDQGGCGSCWAFASAAVLESAAAIAAGPGQLKTLSTQQLVSCVPNP
NQCGGTGGCSGAVAELAFSYTTLYGITSEYKYSYQSYFGTTYSCKYDPKTQSAEVINQGY
ANVTPNDQNALLEAVATVGPIAISVDASNWASYEEGVFDGCDYSKNVDINHAVVLVGYGT
DPKYGDYWLVRNSWGTDYGEDGYIRVKRESVAQCAMDTTPTDGFGCAGDEEPIKVCGMCG
ILSDSAYPLKVQVIG