Identifiers and Description

Gene Model Identifier

TTHERM_00079550

Standard Name

CTH113 (CaTHepsin 113)

Aliases

PreTt10200 | 5.m00551 | 3828.m01464

Description

CTH113 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06987.1 4.997537656037722e-111
Description: papain family cysteine protease containing protein (344 aa)
Oxytricha Contig22708.0.g46 1.9990449803848145e-49
Description: Papain family cysteine protease
DictyBase DDB_G0281605 5.998886722426197e-42
Description: cfaD on chromosome: 3 position 4701100 to 4702904
WormBase WBGene00019986 4.9981275274605926e-36
Description: status:Confirmed UniProt:Q23030 protein_id:CCD69414.1
Stentor Coeruleus SteCoe_27084 5.242885663363464e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079550(coding)
ATGTACAAGTTGCTTTTGGCTACTTTAATTTGCTTGGTTGTAGCTTTACCTACTGCTCTC
TGCTCTCCAAAAAAGCCTGATGTTTCAGTTAAGGACTTACTTACCTACAATTAATGGAGA
AATAAACACTAAAGAGTTTATTTGAATGAACATGAACAACTCTTCAGATAACTTATCTTC
TTAGAAAATCTTGCTAAGGTTAATGAACACAACCAAAAATCAAATGCAACTTATACTATT
GGTTTAAACAAGTTTTCTGACTTTACTTAGGAAGAATTCAAGCACAGAATCCTTAACAAG
AAACTCGGAACTAGAGGTTCAAGATTACTATAAGATACTGATGGAGAAGACATAAATGAC
AACACAGATAATACTGATAACAATGATAACACTGACAACAACGATAACAATGATAACAAT
GATAATAATGACAACAATGACAACAATGATAACAATAACAACGATAACAACAATGACGAC
AACAACAACAATAACAATGACAATAACAATAACAACAATAATAATCAAAACAACACTAAC
ACAACTGTTGCTGCTTCTGTTGATTGGAGAAATGTTAAGAATGTCTTAAACCCTGTTAAG
GATTAAGGATAATGTGGTTCTTGCTGGACTTTTGGTGCTGCTGGTGTCATGGAATCCTTC
AATGCTATTACTAATGGAGTACTCAAGAGCTTTTCTGAATAGTAACTTGTTGACTGTGTT
CATCAAGCTGGTTTCTCTTCTGATGGTTGCAATGGTGGTTTCTAATCAGATGGTGTTGAA
TATGCTATCAAGTTTGGTATTGTTACTGAAGACAAATACCCTTACACTGCTGTTGGTGGT
GATTGTTAAATTAGCAATCCTACTACTGATGGATTCTACCCTAAGACCTATAGAAAACTC
CAACAAACTGTTGATGATTTAAAGGCTAGTCTTAACTTTTCTCCTGTTACCGTTTCAGTT
GATGCCTCAAACTGGAATTCTTACGAAAGTGGTATTTTTGATAACTGTGGAGAAACTACT
TAAGATTAACTTAATCATGCTGTAATTGCTGTTGGTTATGACACAGATGGTAACTGGATT
ATTAGAAACTCTTGGAGTACCTCATGGGGTGAAGATGGTTATATTAGATTAGCTGCTGGT
AACACTTGTGGTGTTTTACTTGATAATTTAATTGTTCTTTCTTGA


>TTHERM_00079550(gene)
ATGTACAAGTTGCTTTTGGCTACTTTAATTTGCTTGGTTGTAGCTTTACCTACTGCTCTC
TGCTCTCCAAAAAAGCCTGATGTTTCAGTTAAGGACTTACTTACCTACAATTAATGGAGA
AATAAACACTAAAGAGTTTATTTGAATGAACATGAACAACTCTTCAGATAACTTATCTTC
TTAGAAAATCTTGCTAAGGTTAATGAACACAACCAAAAATCAAATGCAACTTATACTATT
GGTTTAAACAAGTTTTCTGACTTTACTTAGGAAGAATTCAAGCACAGAATCCTTAACAAG
AAACTCGGAACTAGAGGTTCAAGATTACTATAAGATACTGATGGAGAAGACATAAATGAC
AACACAGATAATACTGATAACAATGATAACACTGACAACAACGATAACAATGATAACAAT
GATAATAATGACAACAATGACAACAATGATAACAATAACAACGATAACAACAATGACGAC
AACAACAACAATAACAATGACAATAACAATAACAACAATAATAATCAAAACAACACTAAC
ACAACTGTTGCTGCTTCTGTTGATTGGAGAAATGTTAAGAATGTCTTAAACCCTGTTAAG
GATTAAGGATAATGTGGTTCTTGCTGGACTTTTGGTGCTGCTGGTGTCATGGAATCCTTC
AATGCTATTACTAATGGAGTACTCAAGAGCTTTTCTGAATAGTAACTTGTTGACTGTGTT
CATCAAGCTGGTTTCTCTTCTGATGGTTGCAATGGTGGTTTCTAATCAGATGGTGTTGAA
TATGCTATCAAGTTTGGTATTGTTACTGAAGACAAATACCCTTACACTGCTGTTGGTGGT
GATTGTTAAATTAGCAATCCTACTACTGATGGATTCTACCCTAAGACCTATAGAAAACTC
CAACAAACTGTTGATGATTTAAAGGCTAGTCTTAACTTTTCTCCTGTTACCGTTTCAGTT
GATGCCTCAAACTGGAATTCTTACGAAAGTGGTATTTTTGATAACTGTGGAGAAACTACT
TAAGATTAACTTAATCATGCTGTAATTGCTGTTGGTTATGACACAGATGGTAACTGGATT
ATTAGAAACTCTTGGAGTACCTCATGGGGTGAAGATGGTTATATTAGATTAGCTGCTGGT
AACACTTGTGGTGTTTTACTTGATAATTTAATTGTTCTTTCTTGA


>TTHERM_00079550(protein)
MYKLLLATLICLVVALPTALCSPKKPDVSVKDLLTYNQWRNKHQRVYLNEHEQLFRQLIF
LENLAKVNEHNQKSNATYTIGLNKFSDFTQEEFKHRILNKKLGTRGSRLLQDTDGEDIND
NTDNTDNNDNTDNNDNNDNNDNNDNNDNNDNNNNDNNNDDNNNNNNDNNNNNNNNQNNTN
TTVAASVDWRNVKNVLNPVKDQGQCGSCWTFGAAGVMESFNAITNGVLKSFSEQQLVDCV
HQAGFSSDGCNGGFQSDGVEYAIKFGIVTEDKYPYTAVGGDCQISNPTTDGFYPKTYRKL
QQTVDDLKASLNFSPVTVSVDASNWNSYESGIFDNCGETTQDQLNHAVIAVGYDTDGNWI
IRNSWSTSWGEDGYIRLAAGNTCGVLLDNLIVLS