Identifiers and Description

Gene Model Identifier

TTHERM_00079570

Standard Name

INP52  (INositol polyphosphate 5-Phosphatase )

Aliases

PreTt10202 | 5.m00553 | 3828.m01465

Description

Endonuclease/Exonuclease/phosphatase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02383 ) SacI homology domain
  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03045.1 9.997093137033517e-262
Description: endonuclease/Exonuclease/phosphatase (899 aa)
Oxytricha Contig21061.0.g48 1.0004771100126706e-129
Description: SacI homology domain
SGD YNL106C 2.000043494209831e-96
Description: INP52 Polyphosphatidylinositol phosphatase, dephosphorylates a number of phosphatidylinositols (PIs) to PI; involved in endocytosis; hyperosmotic stress causes translocation to actin patches; synaptojanin-like protein with a Sac1 domain
DictyBase DDB_G0292392 2.0004907641180118e-81
Description: Dd5P3 on chromosome: 6 position 1583730 to 1588013
WormBase WBGene00006763 5.997225115851065e-74
Description: locus:unc-26 status:Confirmed UniProt:G5EEJ9 protein_id:CAB05234.2
Stentor Coeruleus SteCoe_8915 9.462629465836378e-57
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079570(coding)
ATGGTTGACGCTGTGCAGAGTGCTATAAAAGTTTAGGAAGACAACACTGAAAAGCCAAAG
CAGAATATTCAAGTTGTCTTTGTAACAAGATATACTTCATGCTTTGAGTTATAAATTAAA
TCAAAGAACCCAAAAGTAGATAAAAAGCTAATTATTGAAAAAGCAGGAAGAATTTATGAA
ATTGGGATTGATGATAAGTTTTAAGGCGAAAAACCAATAGAAACATTAAGATTTTCATTA
TTCATGGGTATTTAGTATATTTTGGATGAAAAGTTTCTCGTTTTTGCAGAAAATGTAGCA
CAAACTTGCGCAATTTAAAAGCATGATGTTTTTGAAATATAATCATTATGTTTCGTCTCT
TTCGTTAAAAGTAGAGATTTATTTGTTGGAGAAAAAGGAACTAGATTAGAGTAGTAAATA
ACAAATATAAGAAATCTCTTTTAAGAAGGGTATTATTTTTCTTATACTTATGATCTTAGT
CTTTCAAGATAAAAGCAAGCTTTTTAGGCTGATAGAGAATGGAGATTCGCTTGGAATAGC
TATATGTGCAAAGACTTAATTGCAGCAAAAGTAAAGCCTATTTGGACTATTCCTGTAGTT
TAAGGCTTCGTCTCTAACTTTTAAGTATACATGGTAGGTAAAAAGTTAGACTTTTATTTG
ATAGCTCGTCGTTCATGCAAAAAAGCAGGCACAAGATACAATGCCAGAGGTGTTGATGAT
GAGGGAAATGTTGGTAATTATAATGAAGTGGAGCAGTTCTTTATCTTTAACTAATATTGC
TGCTCTCATTTGTAAATTAGAGGATCGGTACCCATCTTCTGGAAATAAACTGGTATTACA
GCAAATACACAAATTACAAGAACTTTCGAATTTACAAATGGTTCATTTTTAAAGCACTTT
GAAGATGTCAAAAAGAATTACAACTTTGTAATTTGTGTTAATTTGATGAAAAGAGGAAAA
CCTTCTGAATAATTGATTACTGAAGGCTTTGAAGCACATGTTAAAAATAATAATCTAGAT
CATGTCAGATATAAATTTTTTGACTTCCACACTGTATGCAAAAATGAGAAGTATGAAAAT
GTTAATCCAACAATTAGAGAAATGCATAAATACAACTAAAATTTCCTATTTTATGCTGAA
GATTTGTAGAATAAGACTGTTATTTAGACTTAAAAAGGAATTATTCGTACTAATTGCTTA
GATTGTCTTGATAGAACTAATGTATTCCAGAGTAAGATAGCTCTAGATATGTTGGTTGTG
CAGCTGGAAATGCTAGGAGTAAATTTAGCAGAAGAGTTCGGTGAAGACCCTTTGGACCAC
ATTGACAAGAGCAAGAAAGGTAAATGCGATGCATTCACACAAAAATTCAAAGAAATATGG
GCTAATTGCGGTGATATGATATCAAAGCATTATACAGGAACTGGATCTACTCACACTGAT
GTTACTAGAGATGGTACAAGAACATTTGCAGGTCTCATTTAGCACGGTTATAAAACATTG
AATAGATTTTATATGTAGAATTTCGAAGATGACATAAAACAATAAACAATTGATCTTGTT
GTTGGCTAAACAACAGATTGTGTTAACATCTTTAATGAAAGTGTTGAAAATGAATTGATT
AAGAGACAAAATGAATTTTGTACTTTTTCTAAAATTAAAGTCTTCACAATAATATGGAAT
GTTAGTGGCTTTGAATGTCCTGCAGATTTAGATGAAGGTGGAAATTTCTTCGGATTTGAT
AGATCAAACACCCCAGACATTGTAGCAGTGGGTTTACAGGAAATTATATAGTATAATGTT
AAGAGCTTTGTTTCTGTGAATAATGAATCATAAATTAGAAAGTGGAATTAAACCATTACT
AATGCATTGAACAGATACGACAATTACATTCTCACAAAATCAAGAGATTTATATGGCATG
GTATTGCTTGTTTTTTCTAAGAAATCTCTGTAAAATCGTATTTCAAAAATAAATGAAGAT
ACTGTTAAATACGGATACACATCTTATATGGGTGCAGTAGCTATTAAGCTTTATGTTGAT
GACACCTCCATCAATTTTTTGAATGTTAATTTAGATTATTCATCTAAGAGCAAGATTTCA
AGCATTGATGATATACATAAAAATTGCTATCAGCAAGAAGGTGTGCCTGGAAAGAAAAAG
GATGAAAAGATAATAAATTTGAATTTCAATTTCTTAATGGGTGATATAGGATTTAATATC
AATCTTCCAGCTCAAGACATAGTCCAAAACATAGACAATTTTAATTACTTAAAATAAGGA
GATGTATCTAAAGCAGAAAAAGTTCTTGCTAAATTGCTTTTACAAGATGAATTTATTTCT
TAAAAGCAGAACTCAGACTATCTTTAAAAGTACTATGAGCCAAAAATTAATTTCTTACCA
ACATTCAAATACGATTTATCTTCTCCTAACTATGTCTAGTCTGTCGCTCCATCATGGACT
GATAGAATCCTGCTTTGGAGTAGATAGGGAGACAACTTCGATGTTAATGTATATAACAGA
AGAGAAATTGTATATTCTGCCCATAGACCTGTCTATTCATCATATACTCTAACAGTAAAA
AAAATAAACTAATAGATAAGAAAATAGATAGAAGAACAAATACAAGCAGAAATAAACCAG
CAAGCTCAAAAAATTGAAGAAGAGGAAAACTTAGAATTACAAGGATAGAAATGA


>TTHERM_00079570(gene)
ATGGTTGACGCTGTGCAGAGTGCTATAAAAGTTTAGGAAGACAACACTGAAAAGCCAAAG
CAGAATATTCAAGTTGTCTTTGTAACAAGATATACTTCATGCTTTGAGTTATAAATTAAA
TCAAAGAACCCAAAAGTAGATAAAAAGCTAATTATTGAAAAAGCAGGAAGAATTTATGAA
ATTGGGATTGATGATAAGTTTTAAGGCGAAAAACCAATAGAAACATTAAGATTTTCATTA
TTCATGGGTATTTAGTATATTTTGGATGAAAAGTTTCTCGTTTTTGCAGAAAATGTAGCA
CAAACTTGCGCAATTTAAAAGCATGATGTTTTTGAAATATAATCATTATGTTTCGTCTCT
TTCGTTAAAAGTAGAGATTTATTTGTTGGAGAAAAAGGAACTAGATTAGAGTAGTAAATA
ACAAATATAAGAAATCTCTTTTAAGAAGGGTATTATTTTTCTTATACTTATGATCTTAGT
CTTTCAAGATAAAAGCAAGCTTTTTAGGCTGATAGAGAATGGAGATTCGCTTGGAATAGC
TATATGTGCAAAGACTTAATTGCAGCAAAAGTAAAGCCTATTTGGACTATTCCTGTAGTT
TAAGGCTTCGTCTCTAACTTTTAAGTATACATGGTAGGTAAAAAGTTAGACTTTTATTTG
ATAGCTCGTCGTTCATGCAAAAAAGCAGGCACAAGATACAATGCCAGAGGTGTTGATGAT
GAGGGAAATGTTGGTAATTATAATGAAGTGGAGCAGTTCTTTATCTTTAACTAATATTGC
TGCTCTCATTTGTAAATTAGAGGATCGGTACCCATCTTCTGGAAATAAACTGGTATTACA
GCAAATACACAAATTACAAGAACTTTCGAATTTACAAATGGTTCATTTTTAAAGCACTTT
GAAGATGTCAAAAAGAATTACAACTTTGTAATTTGTGTTAATTTGATGAAAAGAGGAAAA
CCTTCTGAATAATTGATTACTGAAGGCTTTGAAGCACATGTTAAAAATAATAATCTAGAT
CATGTCAGATATAAATTTTTTGACTTCCACACTGTATGCAAAAATGAGAAGTATGAAAAT
GTTAATCCAACAATTAGAGAAATGCATAAATACAACTAAAATTTCCTATTTTATGCTGAA
GATTTGTAGAATAAGACTGTTATTTAGACTTAAAAAGGAATTATTCGTACTAATTGCTTA
GATTGTCTTGATAGAACTAATGTATTCCAGAGTAAGATAGCTCTAGATATGTTGGTTGTG
CAGCTGGAAATGCTAGGAGTAAATTTAGCAGAAGAGTTCGGTGAAGACCCTTTGGACCAC
ATTGACAAGAGCAAGAAAGGTAAATGCGATGCATTCACACAAAAATTCAAAGAAATATGG
GCTAATTGCGGTGATATGATATCAAAGCATTATACAGGAACTGGATCTACTCACACTGAT
GTTACTAGAGATGGTACAAGAACATTTGCAGGTCTCATTTAGCACGGTTATAAAACATTG
AATAGATTTTATATGTAGAATTTCGAAGATGACATAAAACAATAAACAATTGATCTTGTT
GTTGGCTAAACAACAGATTGTGTTAACATCTTTAATGAAAGTGTTGAAAATGAATTGATT
AAGAGACAAAATGAATTTTGTACTTTTTCTAAAATTAAAGTCTTCACAATAATATGGAAT
GTTAGTGGCTTTGAATGTCCTGCAGATTTAGATGAAGGTGGAAATTTCTTCGGATTTGAT
AGATCAAACACCCCAGACATTGTAGCAGTGGGTTTACAGGAAATTATATAGTATAATGTT
AAGAGCTTTGTTTCTGTGAATAATGAATCATAAATTAGAAAGTGGAATTAAACCATTACT
AATGCATTGAACAGATACGACAATTACATTCTCACAAAATCAAGAGATTTATATGGCATG
GTATTGCTTGTTTTTTCTAAGAAATCTCTGTAAAATCGTATTTCAAAAATAAATGAAGAT
ACTGTTAAATACGGATACACATCTTATATGGGTGCAGTAGCTATTAAGCTTTATGTTGAT
GACACCTCCATCAATTTTTTGAATGTTAATTTAGATTATTCATCTAAGAGCAAGATTTCA
AGCATTGATGATATACATAAAAATTGCTATCAGCAAGAAGGTGTGCCTGGAAAGAAAAAG
GATGAAAAGATAATAAATTTGAATTTCAATTTCTTAATGGGTGATATAGGATTTAATATC
AATCTTCCAGCTCAAGACATAGTCCAAAACATAGACAATTTTAATTACTTAAAATAAGGA
GATGTATCTAAAGCAGAAAAAGTTCTTGCTAAATTGCTTTTACAAGATGAATTTATTTCT
TAAAAGCAGAACTCAGACTATCTTTAAAAGTACTATGAGCCAAAAATTAATTTCTTACCA
ACATTCAAATACGATTTATCTTCTCCTAACTATGTCTAGTCTGTCGCTCCATCATGGACT
GATAGAATCCTGCTTTGGAGTAGATAGGGAGACAACTTCGATGTTAATGTATATAACAGA
AGAGAAATTGTATATTCTGCCCATAGACCTGTCTATTCATCATATACTCTAACAGTAAAA
AAAATAAACTAATAGATAAGAAAATAGATAGAAGAACAAATACAAGCAGAAATAAACCAG
CAAGCTCAAAAAATTGAAGAAGAGGAAAACTTAGAATTACAAGGATAGAAATGA


>TTHERM_00079570(protein)
MVDAVQSAIKVQEDNTEKPKQNIQVVFVTRYTSCFELQIKSKNPKVDKKLIIEKAGRIYE
IGIDDKFQGEKPIETLRFSLFMGIQYILDEKFLVFAENVAQTCAIQKHDVFEIQSLCFVS
FVKSRDLFVGEKGTRLEQQITNIRNLFQEGYYFSYTYDLSLSRQKQAFQADREWRFAWNS
YMCKDLIAAKVKPIWTIPVVQGFVSNFQVYMVGKKLDFYLIARRSCKKAGTRYNARGVDD
EGNVGNYNEVEQFFIFNQYCCSHLQIRGSVPIFWKQTGITANTQITRTFEFTNGSFLKHF
EDVKKNYNFVICVNLMKRGKPSEQLITEGFEAHVKNNNLDHVRYKFFDFHTVCKNEKYEN
VNPTIREMHKYNQNFLFYAEDLQNKTVIQTQKGIIRTNCLDCLDRTNVFQSKIALDMLVV
QLEMLGVNLAEEFGEDPLDHIDKSKKGKCDAFTQKFKEIWANCGDMISKHYTGTGSTHTD
VTRDGTRTFAGLIQHGYKTLNRFYMQNFEDDIKQQTIDLVVGQTTDCVNIFNESVENELI
KRQNEFCTFSKIKVFTIIWNVSGFECPADLDEGGNFFGFDRSNTPDIVAVGLQEIIQYNV
KSFVSVNNESQIRKWNQTITNALNRYDNYILTKSRDLYGMVLLVFSKKSLQNRISKINED
TVKYGYTSYMGAVAIKLYVDDTSINFLNVNLDYSSKSKISSIDDIHKNCYQQEGVPGKKK
DEKIINLNFNFLMGDIGFNINLPAQDIVQNIDNFNYLKQGDVSKAEKVLAKLLLQDEFIS
QKQNSDYLQKYYEPKINFLPTFKYDLSSPNYVQSVAPSWTDRILLWSRQGDNFDVNVYNR
REIVYSAHRPVYSSYTLTVKKINQQIRKQIEEQIQAEINQQAQKIEEEENLELQGQK