Identifiers and Description

Gene Model Identifier

TTHERM_00079600

Standard Name

CTH109 (CaTHepsin 109)

Aliases

PreTt10205 | 5.m00556 | 3828.m01468

Description

CTH109 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06988.1 3.000071119766155e-172
Description: papain family cysteine protease containing protein (333 aa)
Oxytricha Contig19008.0.g54 3.000458792073453e-56
Description: Papain family cysteine protease
DictyBase DDB_G0272298 1.999683289470905e-41
Description: DDB_G0272298 on chromosome: 2 position 1664020 to 1665049
WormBase WBGene00019986 3.001129784945559e-41
Description: status:Confirmed UniProt:Q23030 protein_id:CCD69414.1
Stentor Coeruleus SteCoe_29303 7.095474162284704e-23
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079600(coding)
ATGGTAAAAATATCTTTGATTGTGATAGCTCTTGCAGCTTTGATTTCTTAAATTCAATGC
TAAACTAATTTGGCAGAATAATTAACTATTTCAGACTTAAAGACTTACAACAAATGGAGA
AGCAGCTATAGAAGAGTCTTTTTAAACGAAGATGAGGAAACATACAGATAACTTGTTTTC
TTTGAGAATCTACAAAAGCTAAAAACTCATGAAAAAAATACAGAAGCAACTTACACCGTT
TCTTTAAATTAGTTCTCTGATTATTCCTAAGAAGAGTTTGTCTAAAGAATATTAAACAAG
CACATCTCAAGATCAGATGCTGATATTCAGAAAGAACAAGAACCAAATGGAAATCTTAGA
AAAGCTGTCAATTACCCTACCTCTGTTGATTGGAGAAATTCTGGTGCACTAAATCCTATT
TAAAATTAAGGTTAATGCGGTTCTTGTGCTGCATTTGGTACTGCTGGAGTTCTTGAATCT
TTTTACTACCTTAAAAGCAAATAGCTTTTAAAGTTCTCTGAGTAACAGCTTCTTGATTGT
GCCAGATAAGCAGGCTTTGATACTTATGGGTGTGACGGAGCATGGTAGTAAGAATATTTT
AAGTATGCAATAAAATATGGTATTGTTCAAGGAAGTTCATATCCATATGTAGGATATCAG
ACAACATGCAAAAATACCTCAAACTTATCAAAGTACTTCCCTCAATCATTCAAGTTTATC
AACCCAAACGCTTCTGATGTTAAAGCTGCCATTTCTCAAGGACCTATTTCTGTAACTGTA
GATGCATCTACTTGGAGCTCTTACAGCGGTGGTATCTTTAATGGTTGCAATAGCAATATA
CAGCTTAATCATGCTGTAATCGCTGTTGGCTATGATACCCAAGGTAATTATATTATCAGA
AATCATTGGGGAACAGGCTGGGGTGAAAAGGGTTACATGAGATTGTCAGCTAATAACAAT
TGTGGAGTTTTAACAAGTGTTATTTAAGTTTTATCTTGA


>TTHERM_00079600(gene)
ATGGTAAAAATATCTTTGATTGTGATAGCTCTTGCAGCTTTGATTTCTTAAATTCAATGC
TAAACTAATTTGGCAGAATAATTAACTATTTCAGACTTAAAGACTTACAACAAATGGAGA
AGCAGCTATAGAAGAGTCTTTTTAAACGAAGATGAGGAAACATACAGATAACTTGTTTTC
TTTGAGAATCTACAAAAGCTAAAAACTCATGAAAAAAATACAGAAGCAACTTACACCGTT
TCTTTAAATTAGTTCTCTGATTATTCCTAAGAAGAGTTTGTCTAAAGAATATTAAACAAG
CACATCTCAAGATCAGATGCTGATATTCAGAAAGAACAAGAACCAAATGGAAATCTTAGA
AAAGCTGTCAATTACCCTACCTCTGTTGATTGGAGAAATTCTGGTGCACTAAATCCTATT
TAAAATTAAGGTTAATGCGGTTCTTGTGCTGCATTTGGTACTGCTGGAGTTCTTGAATCT
TTTTACTACCTTAAAAGCAAATAGCTTTTAAAGTTCTCTGAGTAACAGCTTCTTGATTGT
GCCAGATAAGCAGGCTTTGATACTTATGGGTGTGACGGAGCATGGTAGTAAGAATATTTT
AAGTATGCAATAAAATATGGTATTGTTCAAGGAAGTTCATATCCATATGTAGGATATCAG
ACAACATGCAAAAATACCTCAAACTTATCAAAGTACTTCCCTCAATCATTCAAGTTTATC
AACCCAAACGCTTCTGATGTTAAAGCTGCCATTTCTCAAGGACCTATTTCTGTAACTGTA
GATGCATCTACTTGGAGCTCTTACAGCGGTGGTATCTTTAATGGTTGCAATAGCAATATA
CAGCTTAATCATGCTGTAATCGCTGTTGGCTATGATACCCAAGGTAATTATATTATCAGA
AATCATTGGGGAACAGGCTGGGGTGAAAAGGGTTACATGAGATTGTCAGCTAATAACAAT
TGTGGAGTTTTAACAAGTGTTATTTAAGTTTTATCTTGA


>TTHERM_00079600(protein)
MVKISLIVIALAALISQIQCQTNLAEQLTISDLKTYNKWRSSYRRVFLNEDEETYRQLVF
FENLQKLKTHEKNTEATYTVSLNQFSDYSQEEFVQRILNKHISRSDADIQKEQEPNGNLR
KAVNYPTSVDWRNSGALNPIQNQGQCGSCAAFGTAGVLESFYYLKSKQLLKFSEQQLLDC
ARQAGFDTYGCDGAWQQEYFKYAIKYGIVQGSSYPYVGYQTTCKNTSNLSKYFPQSFKFI
NPNASDVKAAISQGPISVTVDASTWSSYSGGIFNGCNSNIQLNHAVIAVGYDTQGNYIIR
NHWGTGWGEKGYMRLSANNNCGVLTSVIQVLS