Identifiers and Description

Gene Model Identifier

TTHERM_00079640

Standard Name

CTH103 (CaTHepsin 103)

Aliases

PreTt10209 | 5.m00560 | 3828.m01472

Description

CTH103 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06987.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (344 aa)
Oxytricha Contig19092.0.g43 7.997908857293895e-55
Description: Papain family cysteine protease
DictyBase DDB_G0290957 3.0006824396935516e-51
Description: cprA on chromosome: 5 position 4812963 to 4814596
WormBase WBGene00007055 1.999002769139511e-37
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_27084 9.602680054508676e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079640(coding)
ATGTCAAAGTTATTAATTGCAGTCCTACTTTGCTTATCAATCATCACTCCCACTGTCCTT
TGTGACGATTCATAACAAAATATCTCAGTCCAAGACTTATTAGCTTACAATAAGTGGAGA
CAAAAACACCAAAGAGTCTATTTGAATGAAGATGAACAACTCTACAGACAACTTGTTTTC
TTTGAGAACCTTGCTAAAATCAACTCTCATGCTTCCAATACCGAAGCTACTTTCACTGTT
AGTTTGAACTAATTCTCTGACTACACTCAAGAAGAATTTAAACATAGAATCCTCAATAAG
AAGCTCGGTTAGAGATCTACTCCCAGAGAAGCTGTTGCCGAATAACCCCATTTACTAGGT
GCTTCTATTGCTACATCTGTTGATTGGAGAACTAAGCCTAATGTCTTAAACCCTGTTAAG
GACTAAGGACAATGTGGTTCTTGTTGGACATTTGGTGCTGCTGGTGTTATGGAATCATTC
AATGCTATCAAGAATGGTGTTCTTAAAAAATTCTCTGAACAATAGTTGGTTGATTGTGTT
CACTAAGCTGGTTATGTTTCTGATGGTTGCAACGGTGGTTTCTAAGAAGATGGTGTCAAC
TATGCCATTAAGTACGGTATTGTCTAAAGTTCTTCTTATCCATACACAGGTGTTGGTGGA
AGATGCAAGATTACTTCTCCCACTTCTCCTTCAGTTGGATTCTATCCCAAGTCATTCTAA
AAGGTTGCTTAAACCTCAAGTGCTTTAAAGGCAGCTCTTAATTTATATCCAGTAACTGTA
TCTGTTGATGCTTCTAACTGGAGTTCCTACTCTGGTGGTATTTTCAACAACTGTGGTCCT
ACTACTGAACAAGACCTTAATCACGCTGTTATTGCTGTTGGTTATGATACTAAAGGAAAT
TGGATCATAAGAAACTCATGGAGTGCTCATTGGGGAGAGGCTGGCTACATTAGATTAGCT
CCTGGTAACACTTGTGGTGTTCTATTAGATAACTTGTATGTTACTGCTTGA


>TTHERM_00079640(gene)
ATGTCAAAGTTATTAATTGCAGTCCTACTTTGCTTATCAATCATCACTCCCACTGTCCTT
TGTGACGATTCATAACAAAATATCTCAGTCCAAGACTTATTAGCTTACAATAAGTGGAGA
CAAAAACACCAAAGAGTCTATTTGAATGAAGATGAACAACTCTACAGACAACTTGTTTTC
TTTGAGAACCTTGCTAAAATCAACTCTCATGCTTCCAATACCGAAGCTACTTTCACTGTT
AGTTTGAACTAATTCTCTGACTACACTCAAGAAGAATTTAAACATAGAATCCTCAATAAG
AAGCTCGGTTAGAGATCTACTCCCAGAGAAGCTGTTGCCGAATAACCCCATTTACTAGGT
GCTTCTATTGCTACATCTGTTGATTGGAGAACTAAGCCTAATGTCTTAAACCCTGTTAAG
GACTAAGGACAATGTGGTTCTTGTTGGACATTTGGTGCTGCTGGTGTTATGGAATCATTC
AATGCTATCAAGAATGGTGTTCTTAAAAAATTCTCTGAACAATAGTTGGTTGATTGTGTT
CACTAAGCTGGTTATGTTTCTGATGGTTGCAACGGTGGTTTCTAAGAAGATGGTGTCAAC
TATGCCATTAAGTACGGTATTGTCTAAAGTTCTTCTTATCCATACACAGGTGTTGGTGGA
AGATGCAAGATTACTTCTCCCACTTCTCCTTCAGTTGGATTCTATCCCAAGTCATTCTAA
AAGGTTGCTTAAACCTCAAGTGCTTTAAAGGCAGCTCTTAATTTATATCCAGTAACTGTA
TCTGTTGATGCTTCTAACTGGAGTTCCTACTCTGGTGGTATTTTCAACAACTGTGGTCCT
ACTACTGAACAAGACCTTAATCACGCTGTTATTGCTGTTGGTTATGATACTAAAGGAAAT
TGGATCATAAGAAACTCATGGAGTGCTCATTGGGGAGAGGCTGGCTACATTAGATTAGCT
CCTGGTAACACTTGTGGTGTTCTATTAGATAACTTGTATGTTACTGCTTGA


>TTHERM_00079640(protein)
MSKLLIAVLLCLSIITPTVLCDDSQQNISVQDLLAYNKWRQKHQRVYLNEDEQLYRQLVF
FENLAKINSHASNTEATFTVSLNQFSDYTQEEFKHRILNKKLGQRSTPREAVAEQPHLLG
ASIATSVDWRTKPNVLNPVKDQGQCGSCWTFGAAGVMESFNAIKNGVLKKFSEQQLVDCV
HQAGYVSDGCNGGFQEDGVNYAIKYGIVQSSSYPYTGVGGRCKITSPTSPSVGFYPKSFQ
KVAQTSSALKAALNLYPVTVSVDASNWSSYSGGIFNNCGPTTEQDLNHAVIAVGYDTKGN
WIIRNSWSAHWGEAGYIRLAPGNTCGVLLDNLYVTA