Identifiers and Description

Gene Model Identifier

TTHERM_00079900

Standard Name

RAB6C

Aliases

PreTt10235 | 5.m00586 | 3828.m01498

Description

RAB6C small guanosine triphosphatase family (GTPase)-like Ras family protein; Rab VI family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06960.1 2.999370583638828e-134
Description: Ras family protein (227 aa)
DictyBase DDB_G0268068 1.000296925633081e-74
Description: rab6 on chromosome: 1 position 1398472 to 1399280
WormBase WBGene00004269 5.99869294248238e-71
Description: locus:rab-6.1 Ras-related protein Rab-6.1 status:Confirmed UniProt:P34213 protein_id:CAA77590.1
Oxytricha Contig5831.0.g6 5.997672135862771e-69
Description: Ras family
SGD YLR262C 3.0000115468388957e-66
Description: YPT6 Rab family GTPase, Ras-like GTP binding protein involved in the secretory pathway, required for fusion of endosome-derived vesicles with the late Golgi, maturation of the vacuolar carboxypeptidase Y; has similarity to the human GTPase, Rab6
Stentor Coeruleus SteCoe_6177 1.0806392777072785e-30
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00079900(coding)
ATGCAAAACACTACTACAGGACCTGTCGTTAAATTTAAAATAGTTTTTCTTGGTGACTAA
TCAGTAGGAAAAACCTCTATCATCAATCGTTTTATTTACGATAACTTCACTGGAAGTGAA
TAACCTACTGTTGGTATCGATTTCATTTGCAAAACCCTATAAATGGATAATAAAACTTTG
AGACTTCAACTTTGGGATACTGCTGGTTAAGAACGTTTCAAGAGTTTAATTCCCAGTTAT
ATTAGAGATTCAAATGCAGCTATCATTGTTTACGATATCACTAATCAAAATTCCTTTAGC
AATGTCACTAAATGGGTAGAAGAGGTTAAAGAAGAAAGAGGAAACAACGCTTTTATTTTT
ATTTTAGGAAACAAATCTGATTTAGAAGATAGAAAGGTGTCTCTTGAAGAAGGATAGGCT
AAAGCAAAGTAATTTGGTCTTAACTTCTGTGAAGTCTCTGCAAAAACAGGATAAAATATT
AGCAGCTTTTTTAAGAATTTATCTATGACACTCAGTGGAGGAAACTCTAACGAAACCCCT
AATTAGTAGCTATAGACAGATAATAAGTCAGGACAACCATAATAGCCAAGTAATAATAAC
GATAATGCAAATAAAGGCCAAAAATTATAGAATCCTTCAAAAACTGATGATAAGGATAAA
AAGAAAAAAGGAGGATGTTGTTGA


>TTHERM_00079900(gene)
ATGCAAAACACTACTACAGGACCTGTCGTTAAATTTAAAATAGTTTTTCTTGGTGACTAA
TCAGTAGGAAAAACCTCTATCATCAATCGTTTTATTTACGATAACTTCACTGGAAGTGAA
TAAGTATAGCATTTTTAAGATAGTTAATTTTAAAAACTTATAATTGTAGTTAATTCTAAA
ATGCCTGTCAAATAATGCATTATGCATATCAAATTTATAATAAAAATACTTATTTAAATA
TTCAATATATTCAATTTTATTTTTTAATTATGTTAGCCTACTGTTGGTATCGATTTCATT
TGCAAAACCCTATAAATGGATAATAAAACTTTGAGACTTCAACTTTGGGATACTGCTGGT
TAAGAACGTTTCAAGAGTTTAATTCCCAGTTATATTAGAGATTCAAATGCAGCTATCATT
GTTTACGATATCACTAGTATATTCTATATTTTAAATATATTTCTAAGCAAAAAATAGTTT
TATGTTTCTTTTTTTGCTTCTAACGATTAATTATTATTTTGTATTACAAAGATCAAAATT
CCTTTAGCAATGTCACTAAATGGGTAGAAGAGGTTAAAGAAGAAAGAGGAAACAACGCTT
TTATTTTTATTTTAGGAAACAAATCTGATTTAGAAGATAGGTAAAAATTTAAATTTTCTC
AGCTATTAAAATTTGTTTATATATTGTGAACATAATAATAAAGAAAATTAAATTTTTTGT
TTTATTAATTAATCATACAGAAAGGTGTCTCTTGAAGAAGGATAGGCTAAAGCAAAGTAA
TTTGGTCTTAACTTCTGTGAAGTCTCTGCAAAAACAGGATAAAATATTAGCAGCTTTTTT
AAGAATTTATCTATGACACTCAGTGGAGGAAACTCTAACGAAACCCCTAATTAGTAGCTA
TAGACAGATAATAAGTCAGGACAACCATAATAGCCAAGTAATAATAACGATAATGCAAAT
AAAGGCCAAAAATTATAGAATCCTTCAAAAACTGATGATAAGGATAAAAAGAAAAAAGGA
GGATGTTGTTGA


>TTHERM_00079900(protein)
MQNTTTGPVVKFKIVFLGDQSVGKTSIINRFIYDNFTGSEQPTVGIDFICKTLQMDNKTL
RLQLWDTAGQERFKSLIPSYIRDSNAAIIVYDITNQNSFSNVTKWVEEVKEERGNNAFIF
ILGNKSDLEDRKVSLEEGQAKAKQFGLNFCEVSAKTGQNISSFFKNLSMTLSGGNSNETP
NQQLQTDNKSGQPQQPSNNNDNANKGQKLQNPSKTDDKDKKKKGGCC