Identifiers and Description

Gene Model Identifier

TTHERM_00083500

Standard Name

CTH47 (CaTHepsin 47)

Aliases

PreTt16297 | 6.m00371 | 3836.m01968

Description

CTH47 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF00184 ) Neurohypophysial hormones, C-terminal Domain
  • ( PF07599 ) Protein of unknown function (DUF1563)
  • ( PF08127 ) Peptidase family C1 propeptide

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19158.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (347 aa)
WormBase WBGene00000785 9.996584278131743e-91
Description: locus:cpr-5 Cathepsin B-like cysteine proteinase 5 status:Confirmed UniProt:P43509 protein_id:CCD74289.1
DictyBase DDB_G0283921 1.0000310450948521e-65
Description: ctsB on chromosome: 4 position 1297288 to 1298315
Oxytricha Contig8855.0.g51 2.000555387360374e-52
Description: Papain family cysteine protease
Stentor Coeruleus SteCoe_8835 1.0530617357553812e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00083500(coding)
ATGAAACACACTGCTTTAATATTAAGTGCAAGTTTTCTGTTAATTGCTTTAACTGGATTC
GCTACATATGAAATCTTTAGATTTAAGCATCAAAAATACCATGATAGATTAAAATAAATA
GCTGAAAAAGTTAATAATTCTAACACAACATGGAAAGCTGGCGAGAACATTAAGTGGATT
AATTCTGATATTGCTGGAGTTAAGGCTCATATGGGAACCTTGTTGAATTAAAAATCTGGT
GTTAAATTAGAAAAGGTTAATAGGTAAGCTAATAATTTACCCAGTGAATTCGACTCCCGT
GTTTAATGGGGTGACAAGTGCTCATCTTTATGGGAAGTTAGAGATTAATCTAATTGTGGA
TCTTGCTGGGCTTTTGGAGCAGCTGAGTCCTTAAGTGATAGACACTGCATTCACCTTGGC
TAAGATATCAGACTGTCAACTTAAAACCTAGTTACTTGCTGTGATGAATGTGGTTTTGGC
TGCGATGGTGGTTGGCCTGAGGCTGCTATGGACTATTATGTTAACAATGGTCTAGTAACT
GGTGACTTATATGGAAATAACTCCTGGTGCTAAGCTTATTCTCTTGCTCCTTGTGCACAC
CATGTGACTTCTGATGTATATCCTCCTTGCACTGGAGAATTACCTACTCCTCCTTGCGTT
AAATCTTGTGATTCTAATTCCACTTACACCATTCCTTACCCTAAAGATCTTCACAAAGGT
TCAAAGGCTTATAGTATAGATTAAAACGAATAGGCTATTATGACTGAAATTTAAACTAAT
GGACCTATTGAAGTTGCTTTCACTGTATATGAAGATTTCTTAACCTACAAGAGTGGAGTT
TATCAACATGTCACTGGTTCCGAACTAGGTGGACACGCTGTAAAAATGGTAGGTTGGGGA
GTTGAAAATGGTACACCCTACTGGATTATCGTTAATTCATGGAATGAAAGTTGGGGAGAT
AAGGGAACTTTCAAAATTTTGAGAGGTTAAAATGAATGTGGTATCGAATCTGAATGCGTT
ACTGCCCTACCAGCTTACTGA


>TTHERM_00083500(gene)
ATGAAACACACTGCTTTAATATTAAGTGCAAGTTTTCTGTTAATTGCTTTAACTGGATTC
GCTACATATGAAATCTTTAGATTTAAGCATCAAAAATACCATGATAGATTAAAATAAATA
GCTGAAAAAGTTAATAATTCTAACACAACATGGAAAGCTGGCGAGAACATTAAGTGGATT
AATTCTGATATTGCTGGAGTTAAGGCTCATATGGGAACCTTGTTGAATTAAAAATCTGGT
GTTAAATTAGAAAAGGTTAATAGGTAAGCTAATAATTTACCCAGTGAATTCGACTCCCGT
GTTTAATGGGGTGACAAGTGCTCATCTTTATGGGAAGTTAGAGATTAATCTAATTGTGGA
TCTTGCTGGGCTTTTGGAGCAGCTGAGTCCTTAAGTGATAGACACTGCATTCACCTTGGC
TAAGATATCAGACTGTCAACTTAAAACCTAGTTACTTGCTGTGATGAATGTGGTTTTGGC
TGCGATGGTGGTTGGCCTGAGGCTGCTATGGACTATTATGTTAACAATGGTCTAGTAACT
GGTGACTTATATGGAAATAACTCCTGGTGCTAAGCTTATTCTCTTGCTCCTTGTGCACAC
CATGTGACTTCTGATGTATATCCTCCTTGCACTGGAGAATTACCTACTCCTCCTTGCGTT
AAATCTTGTGATTCTAATTCCACTTACACCATTCCTTACCCTAAAGATCTTCACAAAGGT
TCAAAGGCTTATAGTATAGATTAAAACGAATAGGCTATTATGACTGAAATTTAAACTAAT
GGACCTATTGAAGTTGCTTTCACTGTATATGAAGATTTCTTAACCTACAAGAGTGGAGTT
TATCAACATGTCACTGGTTCCGAACTAGGTGGACACGCTGTAAAAATGGTAGGTTGGGGA
GTTGAAAATGGTACACCCTACTGGATTATCGTTAATTCATGGAATGAAAGTTGGGGAGAT
AAGGGAACTTTCAAAATTTTGAGAGGTTAAAATGAATGTGGTATCGAATCTGAATGCGTT
ACTGCCCTACCAGCTTACTGA


>TTHERM_00083500(protein)
MKHTALILSASFLLIALTGFATYEIFRFKHQKYHDRLKQIAEKVNNSNTTWKAGENIKWI
NSDIAGVKAHMGTLLNQKSGVKLEKVNRQANNLPSEFDSRVQWGDKCSSLWEVRDQSNCG
SCWAFGAAESLSDRHCIHLGQDIRLSTQNLVTCCDECGFGCDGGWPEAAMDYYVNNGLVT
GDLYGNNSWCQAYSLAPCAHHVTSDVYPPCTGELPTPPCVKSCDSNSTYTIPYPKDLHKG
SKAYSIDQNEQAIMTEIQTNGPIEVAFTVYEDFLTYKSGVYQHVTGSELGGHAVKMVGWG
VENGTPYWIIVNSWNESWGDKGTFKILRGQNECGIESECVTALPAY