Identifiers and Description

Gene Model Identifier

TTHERM_00083660

Standard Name

RAB64 (RAB GTPase 64)

Aliases

PreTt16313 | 6.m00387 | 3836.m01983

Description

RAB64 Ras family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02392.1 5.000412888119721e-59
Description: Ras family protein (221 aa)
Oxytricha Contig15751.0.0.g87 3.9990760533890984e-36
Description: Ras family
SGD YFL005W 2.0006622580855403e-35
Description: SEC4 Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane
DictyBase DDB_G0283757 2.9990874792167046e-33
Description: rab1A on chromosome: 4 position 1241175 to 1242406
WormBase WBGene00004266 3.00033207980219e-32
Description: locus:rab-1 status:Confirmed UniProt:Q9UAQ6 protein_id:CCD67094.1
Stentor Coeruleus SteCoe_25160 2.3195228302435696e-16
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00083660(coding)
ATGAGAAAATATTCTAATTTCAAGATATGTGGTGCTGAATAAATTTTTATGATAAAAATA
CTTGAAAAAAAAGTAGAGTAAAAGGTTATTTGTGAAAAGTTTATTAATGAGTTTGAATAA
GGAACATTAGGAAATTTGTTTTAAGCTATTAATTATAGGCAACTAAGCAGTTGGAAAGAC
ATGTCTATTGCTGAGATATTGGAAAAGTAAATTTCCAAATAGTAACATAACCACATAGGG
TATTGTATAGATTATTATATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAAATTGTAT
ATTTGGGATACAGCTGGTTCGGAAAGATTTAGAACCATTACTTCAAATTATTTCAAAGCA
GCTCATGGTATTTTAGTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGA
AGCTGGATTTAATGCATAAAAGAAAAATGCGATAATGCTAATATATCTATATTATTAGTT
GGAAATAAATCTGATTCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCT
GAGTAATATAATATTCCTTTTTAGGAAACTAGTGCTCTTGATAATATTAATGTGAGCGAA
TCTTTTGATTAACTTGCTATAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTATT
TCTCCTTAGTCTAATATTCCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGT
TGTTGA


>TTHERM_00083660(gene)
ATGAGAAAATATTCTAATTTCAAGATATGTGGTGCTGAATAAATTTTTATGGTATGATAC
TAACATGATATTCAATAATCAATTAACCTGTAAAGAAGTATTAAATTTTTATAAATTAAA
ACTCAAAAGATAAAAATACTTGAAAAAAAAGTAGAGTAAAAGGTTATTTGTGAAAAGTTT
ATTAATGAGTTTGAATAAGGAACATTAGGAAATTTGTTTTAAGCTATTAATTATAGGCAA
CTAAGCAGTTGGAAAGACATGTCTATTGCTGAGATATTGGAAAAGTAAATTTCCAAATAG
TAACATAACCACATAGGGTATTGTATTTATTGATTATTTTAAAATTAAAAAAATAATGAT
CTAATTGAAAAAAATATAAACATGTAAGTAAATTTTGTTAATAAAAAGGTATAGATTATT
ATATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAAATTGTATATTTGGGATACAGCTG
GTTCGGAAAGATTTAGAACCATTACTTCAAATTATTTCAAAGCAGCTCATGGTATTTTAG
TAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGAAGCTGGATTTAATGCA
TAAAAGAAAAATGCGATAATGCTAATATATCTATATTATTAGTTGGAAATAAATCTGATT
CAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCTGAGTAATATAATATTC
CTTTTTAGGAAACTAGTGCTCTTGATAATATTAATGTGAGCGAATCTTTTGATTAACTTG
CTATAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTATTTCTCCTTAGTCTAATA
TTCCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGTTGTTGA


>TTHERM_00083660(protein)
MRKYSNFKICGAEQIFMIKILEKKVEQKVICEKFINEFEQGTLGNLFQAINYRQLSSWKD
MSIAEILEKQISKQQHNHIGYCIDYYIKKLEINKKKLKLYIWDTAGSERFRTITSNYFKA
AHGILVAYSVEDQESFEKVGSWIQCIKEKCDNANISILLVGNKSDSKQRVVSLEQGEKLA
EQYNIPFQETSALDNINVSESFDQLAIMCLDQYEIKSSTISPQSNIPKKKQENGETKKNC
C