Identifiers and Description

Gene Model Identifier

TTHERM_00083670

Standard Name

RAB65 (RAB GTPase 65)

Aliases

PreTt16314 | 6.m00388 | 3836.m01984

Description

RAB65 Ras family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02392.1 9.996373193201036e-79
Description: Ras family protein (221 aa)
SGD YFL005W 7.998505003885351e-50
Description: SEC4 Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane
WormBase WBGene00004273 9.999142814001536e-47
Description: locus:rab-10 status:Confirmed UniProt:Q94148 protein_id:CCD70773.1
DictyBase DDB_G0280043 9.999142814001536e-47
Description: rab8A on chromosome: 3 position 3266503 to 3267523
Oxytricha Contig11247.0.g57 3.998479955315009e-46
Description: Ras family
Stentor Coeruleus SteCoe_15778 5.242885663363464e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00083670(coding)
ATGAGTTAGAATAAGGATGATTAGCAAATTTATTTTAAAATATTAATGATAGGCAACTCA
GCAGTTGGAAATACATGTCTATTGGTGAGATATTGCAATAGTGAATTTCCAAATAGTAGC
ATAATCACATTGGGTATAGATTTAAAAATAAAAAAACTTGAAATTAATAAAAAAAAGCTT
AATTTGCATATTTTGGATACAGCTAGTTAGGATAAATTTAGAACCATTACTCCAAATTAT
TTCAAAGCAGCTCATGGTATTTTAGTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAG
AAAGTAGGAAGCTGGATTTAATGCATAAAAGAAAATTTCGATAATGCTAATATATCTATA
TTATTAGTTGGAAATAAATCTGATTCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAA
AAGCTTGCTGAGTAATATAATATTCCTTTTTAGGAAACTAGTGCTCTTAATAATATTAAT
GTGAGCGAATCTTTTTATTAACTTGCTAAAATGTGCTTAGATTAGTATGAGATAAAAAGT
TCTACTAGGTCTCCTTAATCTATTGTACCAAAGAAAAAATAAGAAAATGGAGAAACTAAA
AAAAATTGTTGTTGA


>TTHERM_00083670(gene)
ATGAGTTAGAATAAGGATGATTAGCAAATTTATTTTAAAATATTAATGATAGGCAACTCA
GCAGTTGGAAATACATGTCTATTGGTGAGATATTGCAATAGTGAATTTCCAAATAGTAGC
ATAATCACATTGGGTATTGTATTTATTGATTATTTTAAAATTAAAAAAATAATGATCTAA
TTCAAAAAAATATAAACATGTAAAAGTAAATTTCTTTGTTAATAAAAAGGTATAGATTTA
AAAATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAATTTGCATATTTTGGATACAGCT
AGTTAGGATAAATTTAGAACCATTACTCCAAATTATTTCAAAGCAGCTCATGGTATTTTA
GTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGAAGCTGGATTTAATGC
ATAAAAGAAAATTTCGATAATGCTAATATATCTATATTATTAGTTGGAAATAAATCTGAT
TCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCTGAGTAATATAATATT
CCTTTTTAGGAAACTAGTGCTCTTAATAATATTAATGTGAGCGAATCTTTTTATTAACTT
GCTAAAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTAGGTCTCCTTAATCTATT
GTACCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGTTGTTGA


>TTHERM_00083670(protein)
MSQNKDDQQIYFKILMIGNSAVGNTCLLVRYCNSEFPNSSIITLGIDLKIKKLEINKKKL
NLHILDTASQDKFRTITPNYFKAAHGILVAYSVEDQESFEKVGSWIQCIKENFDNANISI
LLVGNKSDSKQRVVSLEQGEKLAEQYNIPFQETSALNNINVSESFYQLAKMCLDQYEIKS
STRSPQSIVPKKKQENGETKKNCC