Identifiers and Description

Gene Model Identifier

TTHERM_000837979

Standard Name

CDK21 (Cyclin-Dependent Kinase 21)

Aliases

None

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; cyclin-dependent kinase-like SerineThreonine kinase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07459.2 6.997194614751282e-100
Description: protein kinase domain-containing protein (597 aa)
Oxytricha Contig11847.0.g48 8.002162267243937e-73
Description: Protein kinase domain
WormBase WBGene00012779 1.0000099287337047e-53
Description: status:Partially_confirmed UniProt:Q9U2H1 protein_id:CAB63367.1
DictyBase DDB_G0288677 2.9994376937714457e-52
Description: cdk5 on chromosome: 5 position 1885785 to 1886770
SGD YPL031C 1.9991939848149086e-44
Description: PHO85 Cyclin-dependent kinase, with ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle
Stentor Coeruleus SteCoe_6331 2.4426007377405277e-36
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000837979(coding)
ATGAATAAGTATTAAGTCTTGAGCATACTTGAAGAAGCTGATTATTTTAAACTTTATAAG
TGTCTTAATAAAGAAACATAAAAAATTATAGCTATTAAGGCATACAAATTAAATATCAAC
TAAGTCGAGGAAAAAAAACGGATAGAGAGGGAAGTAAAGATTAAGAAAATGCTACATCAC
AAAAATATAGTTGATATAATTGAAATTTGTTAAAAGAATAATGAAATATACATTGTTGAA
GAGTATGTAGAAATTAGCTTATCAAATTATCTTAAATAGGGAAGTTAATAAAAAGGATTA
GATTAAAATGTCATTCCAAATATAATGTATTAGGTTTTATCATCTATAAATTAGTGTCAC
AAATATGATATTATTCATTAAAATATTAAACCTATGCATATATATATCAATCCTTCAAAT
TATGAGTTAAAATTAAATGGATTTCGTTTAGCTAGATAATTACCTTAAAAAGGTGAAATA
GTTACAGATTATGTAGAAGCAAGATGGTATAAATCACCAGAGTATCTTTTAGATTACAGA
AAATACGGAAAACCGGAAGATATTTGGGCAGCTGCTTGTGTCATGGCAGAATTAATTGAT
GGTGAACCTTTATTTCCTGGTTAAGGAGAAATAGATTAATTTTATAGGATTGTATAGGTG
ATAGGTCCACTTACAAATTAATATGAGAATTTATTCAAAAAAAAATATAAAGATTTAAAA
TTTCCAATTATTAAAAATTTTAATTCTATTGAATTGAGATATCAAGGCAAAATTAATGCT
GAAGGGCTAGATTTAATGAAAATGATGCTTAAAATGAATCCAGACGAAAGAATAACAGCT
GAATAATCTTTAAGTCATCCTTTCTTTGATAAATTAAAATCAAAAATTGATAATGAAAAG
GGAGCTTTTATATAAAATAAATTATCTAATCAAATAAAAGAAAACTTAAAGAATTAAGCT
CACTAGGATTTATAAAAAAATTGA


>TTHERM_000837979(gene)
ATGAATAAGTATTAAGTCTTGAGCATACTTGAAGAAGCTGATTATTTTAAACTTTATAAG
TGTCTTAATAAAGAAACATAAAAAATTATAGCTATTAAGGCATACAAATTAAATATCAAC
TAAGTCGAGGAAAAAAAACGGATAGAGAGGGAAGTAAAGATTAAGAAAATGCTACATCAC
AAAAATATAGTTGATATAATTGAAATTTGTTAAAAGAATAATGAAATATACATTGTTGAA
GAGTATGTAGAAATTAGCTTATCAAATTATCTTAAATAGGGAAGTTAATAAAAAGGATTA
GATTAAAATGTCATTCCAAATATAATGTATTAGGTTTTATCATCTATAAATTAGTGTCAC
AAATATGATATTATTCATTAAAATATTAAACCTATGCATATATATATCAATCCTTCAAAT
TATGAGTTAAAATTAAATGGATTTCGTTTAGCTAGATAATTACCTTAAAAAGGTGAAATA
GTTACAGATTATGTAGAAGCAAGATGGTATAAATCACCAGAGTATCTTTTAGATTACAGA
AAATACGGAAAACCGGAAGATATTTGGGCAGCTGCTTGTGTCATGGCAGAATTAATTGAT
GGTGAACCTTTATTTCCTGGTTAAGGAGAAATAGATTAATTTTATAGGATTGTATAGGTG
ATAGGTCCACTTACAAATTAATATGAGAATTTATTCAAAAAAAAATATAAAGATTTAAAA
TTTCCAATTATTAAAAATTTTAATTCTATTGAATTGAGATATCAAGGCAAAATTAATGCT
GAAGGGCTAGATTTAATGAAAATGATGCTTAAAATGAATCCAGACGAAAGAATAACAGCT
GAATAATCTTTAAGTCATCCTTTCTTTGATAAATTAAAATCAAAAATTGATAATGAAAAG
GGAGCTTTTATATAAAATAAATTATCTAATCAAATAAAAGAAAACTTAAAGAATTAAGCT
CACTAGGATTTATAAAAAAATTGA


>TTHERM_000837979(protein)
MNKYQVLSILEEADYFKLYKCLNKETQKIIAIKAYKLNINQVEEKKRIEREVKIKKMLHH
KNIVDIIEICQKNNEIYIVEEYVEISLSNYLKQGSQQKGLDQNVIPNIMYQVLSSINQCH
KYDIIHQNIKPMHIYINPSNYELKLNGFRLARQLPQKGEIVTDYVEARWYKSPEYLLDYR
KYGKPEDIWAAACVMAELIDGEPLFPGQGEIDQFYRIVQVIGPLTNQYENLFKKKYKDLK
FPIIKNFNSIELRYQGKINAEGLDLMKMMLKMNPDERITAEQSLSHPFFDKLKSKIDNEK
GAFIQNKLSNQIKENLKNQAHQDLQKN